Clone Name | rbastl50d04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IL22_MOUSE (Q9JJY9) Interleukin-22 precursor (IL-22) (IL-10-rela... | 30 | 4.1 | 2 | IL22B_MOUSE (Q9JJY8) Interleukin-22b precursor (IL-22b) (IL-10-r... | 29 | 5.3 | 3 | ZIMP7_MOUSE (Q8CIE2) PIAS-like protein Zimp7 | 29 | 6.9 | 4 | GAF1_SCHPO (Q10280) Transcription factor gaf1 (Gaf-1) | 29 | 6.9 |
---|
>IL22_MOUSE (Q9JJY9) Interleukin-22 precursor (IL-22) (IL-10-related| T-cell-derived-inducible factor) (IL-TIF) (IL-TIF alpha) (Interleukin-22a) (IL-22a) Length = 179 Score = 29.6 bits (65), Expect = 4.1 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 Query: 192 SSSILLVVLWAVENSSYPVASWCKVE 269 +S +LL+ LWA E ++ PV + CK+E Sbjct: 18 ASCLLLIALWAQEANALPVNTRCKLE 43
>IL22B_MOUSE (Q9JJY8) Interleukin-22b precursor (IL-22b) (IL-10-related| T-cell-derived-inducible factor beta) (IL-TIFb) (IL-TIF beta) Length = 179 Score = 29.3 bits (64), Expect = 5.3 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 192 SSSILLVVLWAVENSSYPVASWCKVE 269 +S +LL+ LWA E ++ P+ + CK+E Sbjct: 18 ASCLLLIALWAQEANALPINTRCKLE 43
>ZIMP7_MOUSE (Q8CIE2) PIAS-like protein Zimp7| Length = 920 Score = 28.9 bits (63), Expect = 6.9 Identities = 24/80 (30%), Positives = 30/80 (37%), Gaps = 1/80 (1%) Frame = -3 Query: 430 SEMTCSGSGASAGLR-KIHYDSPSSIMAQGKD*TWYSQAKCTATAQAGPRDACIYSTLHQ 254 S T +G AGL H PS+ Q + A TATA A A + Q Sbjct: 118 SSFTTGYAGGPAGLGLPTHAARPSTDFTQAAAAAAMAAAAATATATATATVAALQEKQSQ 177 Query: 253 EATGYDEFSTAQRTTSNMLE 194 E + Y T Q S L+ Sbjct: 178 ELSQYGAMGTGQSFNSQFLQ 197
>GAF1_SCHPO (Q10280) Transcription factor gaf1 (Gaf-1)| Length = 855 Score = 28.9 bits (63), Expect = 6.9 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -3 Query: 439 DLNSEMTCSGSGASAGLRKIHYDSPSSIMAQGKD 338 +LN+ + G G S GL H DS S M QGK+ Sbjct: 773 NLNAGVNDFGLGFSEGLGSAHLDSNDSSMVQGKN 806 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,346,865 Number of Sequences: 219361 Number of extensions: 1620720 Number of successful extensions: 3472 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3375 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3471 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)