Clone Name | rbastl50d02 |
---|---|
Clone Library Name | barley_pub |
>INSR_AEDAE (Q93105) Insulin-like receptor precursor (EC 2.7.10.1) (MIR)| [Contains: Insulin-like receptor alpha chain; Insulin-like receptor beta chain] Length = 1390 Score = 31.6 bits (70), Expect = 0.81 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 7/39 (17%) Frame = -2 Query: 128 VRTRTVGTSGV-------YFTTAPSLPSLLRKLCVSRNE 33 V+T T+G+ G+ YFTTAP PS++R + VS N+ Sbjct: 599 VKTYTLGSEGLGGQSKIKYFTTAPGTPSVVRDVEVSVNK 637
>COBL4_ARATH (Q9LFW3) COBRA-like protein 4 precursor| Length = 431 Score = 30.0 bits (66), Expect = 2.4 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -2 Query: 305 HIVCPLRVLWFTARVWTHILLRKL*RTDLVHRSSHTRWGLERDYRNL 165 H +CP+RV W + K+ T+ +R +HT W L + NL Sbjct: 273 HHMCPVRVHWHVKTNYKDYWRVKIAITNFNYRMNHTLWTLAIQHPNL 319
>COBRA_ARATH (Q94KT8) COBRA protein precursor (Cell expansion protein)| Length = 456 Score = 29.3 bits (64), Expect = 4.0 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = -2 Query: 299 VCPLRVLWFTARVWTHILLRKL*RTDLVHRSSHTRWGLERDYRNL 165 +CP+RV W + + K+ T+ +R ++T+W L + NL Sbjct: 297 MCPIRVHWHVKQNYKEYWRVKITITNFNYRLNYTQWNLVAQHPNL 341
>UBP8_SCHPO (Q09738) Probable ubiquitin carboxyl-terminal hydrolase 8 (EC| 3.1.2.15) (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 449 Score = 29.3 bits (64), Expect = 4.0 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +2 Query: 128 PTSLHCTVADIRLSSYNPSPDPTLYGSFYALDLSFTVFSIKCG 256 PT + C + D+ S YN T YG L+L + + CG Sbjct: 186 PTCMTCAIDDMFSSIYNSKNKSTFYGPTAVLNLMWKLSKSLCG 228
>YFEO_SHIFL (P59585) Putative ion-transport protein yfeO| Length = 418 Score = 28.9 bits (63), Expect = 5.3 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +3 Query: 231 LQFSQ*NVGPDPSCEP 278 ++FSQ + GPDP+CEP Sbjct: 74 IRFSQGHAGPDPACEP 89
>YFEO_ECOLI (P67729) Putative ion-transport protein yfeO| Length = 418 Score = 28.9 bits (63), Expect = 5.3 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +3 Query: 231 LQFSQ*NVGPDPSCEP 278 ++FSQ + GPDP+CEP Sbjct: 74 IRFSQGHAGPDPACEP 89
>YFEO_ECOL6 (Q8FFD3) Putative ion-transport protein yfeO| Length = 418 Score = 28.9 bits (63), Expect = 5.3 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +3 Query: 231 LQFSQ*NVGPDPSCEP 278 ++FSQ + GPDP+CEP Sbjct: 74 IRFSQGHAGPDPACEP 89
>YFEO_ECO57 (P67730) Putative ion-transport protein yfeO| Length = 418 Score = 28.9 bits (63), Expect = 5.3 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +3 Query: 231 LQFSQ*NVGPDPSCEP 278 ++FSQ + GPDP+CEP Sbjct: 74 IRFSQGHAGPDPACEP 89
>PA1_PROVU (P37447) Phospholipase A1 precursor (EC 3.1.1.32) (EC 3.1.1.4)| (Detergent-resistant phospholipase A) (DR-phospholipase A) (Phosphatidylcholine 1-acylhydrolase) (Outer membrane phospholipase A) (OM PLA) Length = 289 Score = 28.9 bits (63), Expect = 5.3 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = -3 Query: 190 VWRGIIGT*SYVCYSAMQRGWFEPGPLAQVGCTSPLRQ 77 +WRGI+G S + S QR W++ L+ G ++P R+ Sbjct: 97 LWRGILGDNSLLGASYTQRSWWQ---LSNTGESAPFRE 131
>POLR_KYMVJ (P36304) RNA replicase polyprotein (EC 2.7.7.48)| Length = 1874 Score = 28.1 bits (61), Expect = 9.0 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 110 QRSWFE-PTSLHCTVADIRLSSYNPSPDPTL 199 Q WF+ P SL C + + + ++PS DPTL Sbjct: 1404 QFPWFDRPFSLSCQPSSLIAAKHSPSQDPTL 1434
>BCAL1_ARATH (Q8W0Z7) Branched-chain-amino-acid aminotransferase-like protein 1| (Atbcat-like) Length = 555 Score = 28.1 bits (61), Expect = 9.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -2 Query: 191 GLERDYRNLVLCLLQCNAERLVRTRTVGT 105 G +R YR+ VL ++CN E++V+ G+ Sbjct: 46 GFDRPYRDEVLSKMECNGEKVVKDVIYGS 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,365,683 Number of Sequences: 219361 Number of extensions: 1442386 Number of successful extensions: 2932 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2854 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2932 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)