Clone Name | rbastl50c12 |
---|---|
Clone Library Name | barley_pub |
>ASPM_FELCA (P62288) Abnormal spindle-like microcephaly-associated protein| homolog (Fragment) Length = 3461 Score = 32.0 bits (71), Expect = 0.79 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 353 WKIAPLLACAEHSACHSNGRSSSTGQNLLRKS 448 W A L+AC++ + CHS GR++ T Q K+ Sbjct: 2798 WHRASLVACSQEAECHSQGRAAVTIQKAFCKT 2829
>ASPM_MACMU (P62292) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3479 Score = 31.2 bits (69), Expect = 1.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 353 WKIAPLLACAEHSACHSNGRSSSTGQNLLRK 445 W A LAC++ + CHS R++ T QN R+ Sbjct: 2800 WYKASDLACSQEAECHSQSRAAVTIQNAFRR 2830
>ASPM_MACFA (P62291) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3476 Score = 31.2 bits (69), Expect = 1.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 353 WKIAPLLACAEHSACHSNGRSSSTGQNLLRK 445 W A LAC++ + CHS R++ T QN R+ Sbjct: 2797 WYKASDLACSQEAECHSQSRAAVTIQNAFRR 2827
>PER1_HUMAN (O15534) Period circadian protein 1 (Circadian pacemaker protein| Rigui) (hPER) Length = 1290 Score = 29.6 bits (65), Expect = 3.9 Identities = 18/50 (36%), Positives = 22/50 (44%) Frame = +1 Query: 67 SPFGMRSSNHGPAPRSVTTYKQHSLWKLVQYKHHH*PLARRYMYSSFALP 216 S G R +HGPAP S + H K + +HH P A Y S P Sbjct: 815 SALGERGCHHGPAPPS---RRHHCRSKAKRSRHHQNPRAEAPCYVSHPSP 861
>TAOK2_XENLA (Q6GPK9) Serine/threonine-protein kinase TAO2 (EC 2.7.11.1) (Thousand| and one amino acid protein 2) Length = 1025 Score = 29.3 bits (64), Expect = 5.1 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 5/55 (9%) Frame = +2 Query: 311 TKMSPPF-HWNKHPMWKIAPLLACAEHSACHSNGRSSSTGQN----LLRKSCQPL 460 T ++PP W HP + L A S+ S+ SSS+G LLR S QPL Sbjct: 939 TLLAPPSASWGLHPPGSSSSLSALPSSSSSSSSSPSSSSGGRPGLLLLRNSPQPL 993
>DPH1_SCHPO (O59713) Diphthamide biosynthesis protein 1| Length = 436 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -1 Query: 365 GQFSTLDAYSNGMADSFLSKPWLYSYPNPMVNP 267 GQFS +DA+ +A LS W Y++P P++ P Sbjct: 355 GQFSDIDAWIQ-VACPRLSIDWGYAFPAPLLTP 386
>ALG9_MOUSE (Q8VDI9) Alpha-1,2-mannosyltransferase ALG9 (EC 2.4.1.-)| (Asparagine-linked glycosylation protein 9 homolog) (Disrupted in bipolar disorder protein 1 homolog) Length = 611 Score = 28.5 bits (62), Expect = 8.7 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 385 LCTGQERGNFPHWMLIPMEWRTHFCPS 305 +C G+E FP L+P W+ F PS Sbjct: 466 VCVGKEWYRFPSSFLLPDNWQLQFIPS 492
>ALG9_HUMAN (Q9H6U8) Alpha-1,2-mannosyltransferase ALG9 (EC 2.4.1.-)| (Asparagine-linked glycosylation protein 9 homolog) (Disrupted in bipolar disorder protein 1) Length = 611 Score = 28.5 bits (62), Expect = 8.7 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 385 LCTGQERGNFPHWMLIPMEWRTHFCPS 305 +C G+E FP L+P W+ F PS Sbjct: 466 VCVGKEWYRFPSSFLLPDNWQLQFIPS 492 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,316,202 Number of Sequences: 219361 Number of extensions: 1718380 Number of successful extensions: 4170 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4022 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4169 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)