| Clone Name | rbastl50a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BGAL_LYCES (P48980) Beta-galactosidase precursor (EC 3.2.1.23) (... | 31 | 1.1 | 2 | HEM4_BACSU (P21248) Uroporphyrinogen-III synthase (EC 4.2.1.75) ... | 28 | 9.2 | 3 | BGAL_ASPOF (P45582) Beta-galactosidase precursor (EC 3.2.1.23) (... | 28 | 9.2 |
|---|
>BGAL_LYCES (P48980) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 835 Score = 31.2 bits (69), Expect = 1.1 Identities = 15/22 (68%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = -2 Query: 371 KNFG-DPCRGVTKSLVVEAACS 309 +NFG DPCR V K L VEA CS Sbjct: 814 ENFGGDPCRNVLKKLSVEAICS 835
>HEM4_BACSU (P21248) Uroporphyrinogen-III synthase (EC 4.2.1.75) (UROS)| (Uroporphyrinogen-III cosynthetase) (Hydroxymethylbilane hydrolyase [cyclizing]) Length = 262 Score = 28.1 bits (61), Expect = 9.2 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +1 Query: 259 IWFRPLLPTNNIYETCHEHAASTTRLFVTPLHGSPKFFADTGTLQLLTPTH 411 I FR LP N++ E E A+ L T ++G+ FF+ QL+ P H Sbjct: 41 ITFRRALP-NDVAEQVREDLAAPGWLVFTSVNGADFFFSYLKENQLILPAH 90
>BGAL_ASPOF (P45582) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 832 Score = 28.1 bits (61), Expect = 9.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 362 GDPCRGVTKSLVVEAAC 312 GDPC G K L VEA C Sbjct: 815 GDPCPGTMKKLAVEAIC 831 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,079,981 Number of Sequences: 219361 Number of extensions: 1093167 Number of successful extensions: 2284 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2233 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2278 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)