Clone Name | rbastl50a05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FBW12_HUMAN (Q6X9E4) F-box/WD-repeat protein 12 (F-box and WD-40... | 30 | 1.8 | 2 | ECM1_HUMAN (Q16610) Extracellular matrix protein 1 precursor (Se... | 29 | 4.0 | 3 | BTKL_DROME (P08630) Tyrosine-protein kinase Btk29A (EC 2.7.10.2)... | 29 | 4.0 | 4 | UBP3_SCHPO (O94269) Probable ubiquitin carboxyl-terminal hydrola... | 28 | 6.9 |
---|
>FBW12_HUMAN (Q6X9E4) F-box/WD-repeat protein 12 (F-box and WD-40 domain protein| 12) (F-box only protein 35) Length = 464 Score = 30.4 bits (67), Expect = 1.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 334 RHQQMLTCCHLCSTFHTSDTQAIFSSV 414 RH + +CCHL +T+H T + SSV Sbjct: 411 RHPYLRSCCHLENTWHDHTTDSCISSV 437
>ECM1_HUMAN (Q16610) Extracellular matrix protein 1 precursor (Secretory| component p85) Length = 540 Score = 29.3 bits (64), Expect = 4.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 291 CPSHQPKIRWHNRTKTPTNVDLLSSVQHISHFR 389 CPSHQP I P V L ++++I H R Sbjct: 284 CPSHQPDISSGLELPFPPGVPTLDNIKNICHLR 316
>BTKL_DROME (P08630) Tyrosine-protein kinase Btk29A (EC 2.7.10.2) (Dsrc28C)| Length = 786 Score = 29.3 bits (64), Expect = 4.0 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 225 VLEMPKN*QSEVHDISCLPWQYCPSHQPKIR 317 +LE PK+ E++D+ L W + P +P R Sbjct: 741 ILEKPKSCAKEIYDVMKLCWSHGPEERPAFR 771
>UBP3_SCHPO (O94269) Probable ubiquitin carboxyl-terminal hydrolase 3 (EC| 3.1.2.15) (Ubiquitin thioesterase 3) (Ubiquitin-specific processing protease 3) (Deubiquitinating enzyme 3) Length = 512 Score = 28.5 bits (62), Expect = 6.9 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 270 SCLPWQYCPSHQPKIRWHNRTKTPTNVDLLSSVQ 371 S LPW C H+ R + ++P N+D SVQ Sbjct: 26 SLLPWYSCSEHEFPHRKARKRRSPKNLDWSVSVQ 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,282,568 Number of Sequences: 219361 Number of extensions: 1202668 Number of successful extensions: 2669 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2669 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)