| Clone Name | rbastl50a04 |
|---|---|
| Clone Library Name | barley_pub |
>NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (Motch B) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2470 Score = 30.4 bits (67), Expect = 1.2 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = -1 Query: 189 CVCV-------CDKKLCRCMNN*GNRGACPMGLIGMRKLSSAGYRSMDCRVQK 52 C+C C ++ C++N G C GL G + L AG+ ++C V K Sbjct: 704 CICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDK 756
>NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (hN2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 30.4 bits (67), Expect = 1.2 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = -1 Query: 189 CVCV-------CDKKLCRCMNN*GNRGACPMGLIGMRKLSSAGYRSMDCRVQK 52 C+C C ++ C++N G C GL G + L AG+ ++C V K Sbjct: 706 CICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDK 758
>FP2_MYTGA (Q25464) Adhesive plaque matrix protein 2 precursor (Foot protein| 2) (MGFP2) (MGFP-2) Length = 473 Score = 28.5 bits (62), Expect = 4.6 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 11/55 (20%) Frame = -1 Query: 189 CVC-------VCDKKLCR---CMNN*GNRGAC-PMGLIGMRKLSSAGYRSMDCRV 58 CVC +C+K +C C NN G C P+G G + S GY C V Sbjct: 106 CVCRNGNFGRLCEKNVCSPNPCKNN----GKCSPLGKTGYKCTCSGGYTGPRCEV 156
>NOTC2_RAT (Q9QW30) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 28.1 bits (61), Expect = 6.0 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -1 Query: 177 CDKKLCRCMNN*GNRGACPMGLIGMRKLSSAGYRSMDCRVQK 52 C ++ C+++ G C GL G + L AG+ ++C V K Sbjct: 717 CYSQVNECLSSPCIHGNCTGGLSGYKCLCDAGWVGINCEVDK 758
>TENA_HUMAN (P24821) Tenascin precursor (TN) (Hexabrachion) (Cytotactin)| (Neuronectin) (GMEM) (JI) (Miotendinous antigen) (Glioma-associated-extracellular matrix antigen) (GP 150-225) (Tenascin-C) (TN-C) Length = 2201 Score = 27.7 bits (60), Expect = 7.9 Identities = 22/79 (27%), Positives = 33/79 (41%) Frame = -1 Query: 255 EHVRCRDLMLLCYPCLLTPELACVCVCDKKLCRCMNN*GNRGACPMGLIGMRKLSSAGYR 76 EH C D + +C+ + C+K LC +NN NRG C + + G+ Sbjct: 259 EHGTCVDGLCVCHDGFAGDD------CNKPLC--LNNCYNRGRC----VENECVCDEGFT 306 Query: 75 SMDCRVQKKSLVLPNNEVD 19 DC L+ PN+ D Sbjct: 307 GEDC----SELICPNDCFD 321
>CHK1_HUMAN (O14757) Serine/threonine-protein kinase Chk1 (EC 2.7.11.1)| Length = 476 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 124 PDGFDRHAEAQLSWLPVNGLSCAEKI 47 P GF +H ++ L + PVN S E + Sbjct: 287 PSGFSKHIQSNLDFSPVNSASSEENV 312 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,137,501 Number of Sequences: 219361 Number of extensions: 829349 Number of successful extensions: 1634 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1590 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1632 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)