Clone Name | rbastl50a01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GLMS_TREPA (O83833) Glucosamine--fructose-6-phosphate aminotrans... | 31 | 0.94 | 2 | MURE_LISMO (Q8Y5L9) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-... | 29 | 3.6 |
---|
>GLMS_TREPA (O83833) Glucosamine--fructose-6-phosphate aminotransferase| [isomerizing] (EC 2.6.1.16) (Hexosephosphate aminotransferase) (D-fructose-6-phosphate amidotransferase) (GFAT) (L-glutamine-D-fructose-6-phosphate amidotransferase) (Glucosamine-6-ph Length = 634 Score = 30.8 bits (68), Expect = 0.94 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -2 Query: 152 CN*LQSCLVARMDRHATCTHSGGHVGVELVVSFDLKLICICI 27 CN +S LV D TH+G +GV SF +L+C+ + Sbjct: 387 CNGARSTLVRESDA-VLLTHAGSEIGVASTKSFTTQLVCLLV 427
>MURE_LISMO (Q8Y5L9) UDP-N-acetylmuramoylalanyl-D-glutamate--2,| 6-diaminopimelate ligase (EC 6.3.2.13) (UDP-N-acetylmuramyl-tripeptide synthetase) (Meso-diaminopimelate-adding enzyme) (UDP-MurNAc-tripeptide synthetase) Length = 491 Score = 28.9 bits (63), Expect = 3.6 Identities = 22/95 (23%), Positives = 40/95 (42%), Gaps = 6/95 (6%) Frame = +3 Query: 9 NFQYTLDTYTNKLKVKRHHQFNSYMSTRVGTSGMPVHSGNQTRLQLVTA---LVDGIKMF 179 ++ +T++ Y N + NSY ++ + + R+Q TA + GIK Sbjct: 205 DYHHTMEEYANAKSLLFAQLGNSYHTSNPKIAVLNADDAESVRMQKATAAHIITFGIKQE 264 Query: 180 LDEPPANAEV*EHSEGSSVTT---TFTSEHAMLGN 275 D +N ++ H + T FT + M+GN Sbjct: 265 ADFQASNIKITSHGSTFDLGTPVGNFTLKIKMIGN 299 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,243,772 Number of Sequences: 219361 Number of extensions: 953612 Number of successful extensions: 2696 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2641 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2696 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)