ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl47g08 |
|---|---|
| Clone Library Name | barley_pub |
>EZ2_MAIZE (Q8S4P5) Polycomb protein EZ2 (Enhancer of zeste protein 2)| Length = 894 Score = 69.3 bits (168), Expect = 2e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 379 RYGPDQAPAWARRPEGAKKDEASGSHRRAHKVA 281 RYGPDQAPAWARRPEG+KKDEAS SHRRAHKVA Sbjct: 861 RYGPDQAPAWARRPEGSKKDEASVSHRRAHKVA 893
>EZ3_MAIZE (Q8S4P4) Polycomb protein EZ3 (Enhancer of zeste protein 3)| Length = 895 Score = 67.4 bits (163), Expect = 8e-12 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 379 RYGPDQAPAWARRPEGAKKDEASGSHRRAHKVA 281 RYGPDQAPAWARRPEG+KKDEAS SH RAHKVA Sbjct: 862 RYGPDQAPAWARRPEGSKKDEASVSHHRAHKVA 894
>EZA1_ARATH (Q9ZSM8) Probable Polycomb group protein EZA1 (CURLY LEAF-like 1)| (Protein SET DOMAIN GROUP 10) Length = 856 Score = 55.5 bits (132), Expect = 3e-08 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -2 Query: 379 RYGPDQAPAWARRPEGAKKDEASGSHRRAHK 287 RYGPDQAP WAR+PEG+KKD+++ +HRRA K Sbjct: 822 RYGPDQAPVWARKPEGSKKDDSAITHRRARK 852
>EZ1_MAIZE (Q8S4P6) Polycomb protein EZ1 (Enhancer of zeste protein 1)| Length = 931 Score = 38.1 bits (87), Expect = 0.005 Identities = 18/34 (52%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = -2 Query: 379 RYGPDQAPAWARRPEGA-KKDEASGSHRRAHKVA 281 RY PD+APAWAR+PE + KD+ + RA K+A Sbjct: 893 RYEPDRAPAWARKPEASGAKDDGQPFNGRAKKLA 926
>CLF_ARATH (P93831) Polycomb group protein CURLY LEAF (Protein INCURVATA 1)| (Protein photoperiod insensitive flowering) (Protein SET DOMAIN GROUP 1) Length = 902 Score = 37.4 bits (85), Expect = 0.009 Identities = 16/23 (69%), Positives = 20/23 (86%), Gaps = 2/23 (8%) Frame = -2 Query: 379 RYGPDQAPAWARRPE--GAKKDE 317 RY PD+APAWA++PE G+KKDE Sbjct: 867 RYEPDRAPAWAKKPEAPGSKKDE 889
>CYSP3_HOMAM (P25784) Digestive cysteine proteinase 3 precursor (EC 3.4.22.-)| Length = 321 Score = 33.5 bits (75), Expect = 0.13 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -3 Query: 300 VEHTK--LLDS*RAVPMIQAAVNYSHTSTKFYPSSLYKETNCWP 175 V+HT+ L ++ V I A++ SH S +FY S +Y E NC P Sbjct: 220 VQHTEEALQEAVSGVGPISVAIDASHFSFQFYSSGVYYEQNCSP 263
>HGPC_HAEIN (Q9X442) Hemoglobin and hemoglobin-haptoglobin-binding protein C| precursor Length = 1066 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 162 HSFYQANNWSPCIMNWDRILLKYGNSLQQPVSSELLFNYQ 281 HS+ N P NW R+ LKY N + P S E+ ++ Sbjct: 730 HSYNLGLNLDPT--NWLRVQLKYANGFRAPTSDEIYMTFK 767
>DADA_YERPE (Q8ZEL7) D-amino acid dehydrogenase small subunit (EC 1.4.99.1)| Length = 434 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 14/52 (26%) Frame = -2 Query: 295 AHKVA**LKSSSDDTGCCKLFP--------------YFNKILSQFIIQGDQL 182 AHK+ L+ +D+TG CKLF FN+ + + +++GDQ+ Sbjct: 183 AHKLTGGLRLPNDETGDCKLFTERLAKMAEQAGVKFIFNRSVDKLLVEGDQI 234
>IRK1_RAT (P35560) ATP-sensitive inward rectifier potassium channel 1| (Potassium channel, inwardly rectifying subfamily J member 1) (ATP-regulated potassium channel ROM-K) (KAB-1) (Kir1.1) Length = 391 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = +3 Query: 129 WYLGFYFLRNTHSFYQANNWSPCIMNWDRILLKYGNSLQQPVSSELLFNYQATLCA 296 WY+ Y ++ FY +N +PC+ N + + + SL+ V+ F + CA Sbjct: 99 WYVVAYVHKDLPEFYPPDNRTPCVENINGMTSAFLFSLETQVTIGYGFRFVTEQCA 154
>CATL_RAT (P07154) Cathepsin L precursor (EC 3.4.22.15) (Major excreted| protein) (MEP) (Cyclic protein 2) (CP-2) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 334 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 285 LLDS*RAVPMIQAAVNYSHTSTKFYPSSLYKETNC 181 L+ + V I A++ SH S +FY S +Y E NC Sbjct: 235 LMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNC 269
>CATL_MOUSE (P06797) Cathepsin L precursor (EC 3.4.22.15) (Major excreted| protein) (MEP) (p39 cysteine proteinase) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 334 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 285 LLDS*RAVPMIQAAVNYSHTSTKFYPSSLYKETNC 181 L+ + V I A++ SH S +FY S +Y E NC Sbjct: 235 LMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNC 269
>CATJ_RAT (Q63088) Cathepsin J precursor (EC 3.4.22.-) (Cathepsin P)| (Cathepsin L-related protein) (Catlrp-p) Length = 334 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 255 IQAAVNYSHTSTKFYPSSLYKETNC 181 + AA++ SH S +FY +Y E NC Sbjct: 245 VSAAIDASHDSFRFYSGGVYHEPNC 269
>IRK1_MOUSE (O88335) ATP-sensitive inward rectifier potassium channel 1| (Potassium channel, inwardly rectifying subfamily J member 1) (ATP-regulated potassium channel ROM-K) (Kir1.1) Length = 372 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = +3 Query: 129 WYLGFYFLRNTHSFYQANNWSPCIMNWDRILLKYGNSLQQPVSSELLFNYQATLCA 296 WY+ Y ++ FY +N +PC+ N + + + SL+ V+ F + CA Sbjct: 80 WYVVAYVHKDLPEFYPPDNRTPCVENINGMTSAFLFSLETQVTIGYGFRFVTEQCA 135
>VNS3_RSVT (P26658) Nonstructural protein NS3| Length = 211 Score = 30.0 bits (66), Expect = 1.4 Identities = 19/65 (29%), Positives = 30/65 (46%) Frame = -3 Query: 321 MKHLVLIVEHTKLLDS*RAVPMIQAAVNYSHTSTKFYPSSLYKETNCWPDKKNVYSLRNK 142 +K L+ I+ H K L +P I + +Y T+ P TNCW + + +L Sbjct: 76 LKTLIWILSHDKNLPEEYRLPTIMMSSSYVKFFTEVKPRP--PSTNCWTCRMSKDNLPFT 133 Query: 141 IPSTK 127 +PS K Sbjct: 134 VPSVK 138
>VNS3_RSVM (Q01210) Nonstructural protein NS3| Length = 211 Score = 30.0 bits (66), Expect = 1.4 Identities = 19/65 (29%), Positives = 30/65 (46%) Frame = -3 Query: 321 MKHLVLIVEHTKLLDS*RAVPMIQAAVNYSHTSTKFYPSSLYKETNCWPDKKNVYSLRNK 142 +K L+ I+ H K L +P I + +Y T+ P TNCW + + +L Sbjct: 76 LKTLIWILSHDKNLPEEYRLPTIMMSSSYVKFFTEVKPRP--PSTNCWTCRMSKDNLPFT 133 Query: 141 IPSTK 127 +PS K Sbjct: 134 VPSVK 138
>CATJ_MOUSE (Q9R014) Cathepsin J precursor (EC 3.4.22.-) (Cathepsin P)| (Cathepsin L-related protein) (Catlrp-p) Length = 334 Score = 29.6 bits (65), Expect = 1.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 255 IQAAVNYSHTSTKFYPSSLYKETNC 181 + AA++ SH S +FY +Y E NC Sbjct: 245 VSAAIDASHDSFRFYNGGIYYEPNC 269
>VGLG_VSVIG (P04883) Spike glycoprotein precursor| Length = 511 Score = 29.3 bits (64), Expect = 2.4 Identities = 27/102 (26%), Positives = 39/102 (38%), Gaps = 3/102 (2%) Frame = +2 Query: 62 VYTQLCYHSDYQ*KLICQSSTSLVLGILFLKEYTFFLSGQQLVSLYNELG*NFVEVWE*F 241 V+ +HSDY+ K +C S+ L + TFF ++L SL E Sbjct: 177 VHNSTTWHSDYKVKGLCDSN-------LISTDITFFSEDRELSSLGKE------------ 217 Query: 242 TAACIIGTALQLSSNFVCSTMRTRCFILFCSFWS---PSPGW 358 GT + S+ F T C + +C W PS W Sbjct: 218 ------GTGFR-SNYFAYETGDKACKMQYCKHWGVRLPSGVW 252
>HHUA_HAEIN (Q48153) Hemoglobin-haptoglobin-binding protein A precursor| (Hemoglobin-haptoglobin utilization protein A) Length = 1046 Score = 29.3 bits (64), Expect = 2.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 201 MNWDRILLKYGNSLQQPVSSELLFNY 278 +NW R+ KYG + + P S E+ F + Sbjct: 769 LNWLRLQAKYGKAFRAPTSDEIYFTF 794
>HGP1_HAEIN (P44795) Probable hemoglobin and hemoglobin-haptoglobin-binding| protein 1 precursor Length = 1063 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 162 HSFYQANNWSPCIMNWDRILLKYGNSLQQPVSSELLFNYQ 281 HS+ N P +W R+ LKY N+ + P S E+ ++ Sbjct: 731 HSYNLGLNLDPT--DWLRVQLKYANAFRAPTSDEIYMTFK 768
>CYSP2_HOMAM (P25782) Digestive cysteine proteinase 2 precursor (EC 3.4.22.-)| Length = 323 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -3 Query: 291 TKLLDS*RAVPMIQAAVNYSHTSTKFYPSSLYKETNCWP 175 T L + R + I ++ +H+S +FY S +Y E +C P Sbjct: 227 TGLQQAVRDIGPISVTIDAAHSSFQFYSSGVYYEPSCSP 265
>SYFB_PROMA (Q7VBX6) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 837 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/40 (37%), Positives = 26/40 (65%) Frame = +1 Query: 205 TGIEFC*SMGIVYSSLYHRNCSSTIKQLCVLDDENQMLHP 324 + +++ S GI++S+L N + T ++L DENQ+LHP Sbjct: 647 SSLDYFQSRGILHSALNSLNINITDEKL----DENQLLHP 682
>HGP3_HAEIN (P44836) Probable hemoglobin and hemoglobin-haptoglobin-binding| protein 3 precursor Length = 1084 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 162 HSFYQANNWSPCIMNWDRILLKYGNSLQQPVSSELLFNYQ 281 HS+ N P +W R+ LKY N + P S E+ ++ Sbjct: 748 HSYNLGLNLDPT--DWLRVQLKYANGFRAPTSDEIYMTFK 785
>HGBB_HAEIN (Q9KIV1) Hemoglobin and hemoglobin-haptoglobin-binding protein B| precursor (Hemoglobin-binding protein B) Length = 1067 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 162 HSFYQANNWSPCIMNWDRILLKYGNSLQQPVSSELLFNYQ 281 HS+ N P +W R+ LKY N + P S E+ ++ Sbjct: 731 HSYNLGLNLDPT--DWLRVQLKYANGFRAPTSDEIYMTFK 768
>IFNB_CHICK (Q90873) Interferon type B precursor| Length = 203 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 147 FLRNTHSFYQANNWSPCIMNWDRILLK 227 + R+ H+F Q NN+S C WD + L+ Sbjct: 148 YFRSIHNFLQHNNYSAC--TWDHVRLQ 172
>VGLG_VSVSJ (P03522) Spike glycoprotein precursor| Length = 511 Score = 28.1 bits (61), Expect = 5.4 Identities = 27/102 (26%), Positives = 38/102 (37%), Gaps = 3/102 (2%) Frame = +2 Query: 62 VYTQLCYHSDYQ*KLICQSSTSLVLGILFLKEYTFFLSGQQLVSLYNELG*NFVEVWE*F 241 V+ +HSDY+ K +C S+ L + TFF +L SL E Sbjct: 177 VHNSTTWHSDYKVKGLCDSN-------LISMDITFFSEDGELSSLGKE------------ 217 Query: 242 TAACIIGTALQLSSNFVCSTMRTRCFILFCSFWS---PSPGW 358 GT + S+ F T C + +C W PS W Sbjct: 218 ------GTGFR-SNYFAYETGGKACKMQYCKHWGVRLPSGVW 252
>VGLG_VSVO (P04884) Spike glycoprotein precursor| Length = 511 Score = 28.1 bits (61), Expect = 5.4 Identities = 27/102 (26%), Positives = 38/102 (37%), Gaps = 3/102 (2%) Frame = +2 Query: 62 VYTQLCYHSDYQ*KLICQSSTSLVLGILFLKEYTFFLSGQQLVSLYNELG*NFVEVWE*F 241 V+ +HSDY+ K +C S+ L + TFF +L SL E Sbjct: 177 VHNSTTWHSDYKVKGLCDSN-------LISTDITFFSEDGELSSLGKE------------ 217 Query: 242 TAACIIGTALQLSSNFVCSTMRTRCFILFCSFWS---PSPGW 358 GT + S+ F T C + +C W PS W Sbjct: 218 ------GTGFR-SNYFAYETGDKACKMQYCKHWGVRLPSGVW 252
>WC1_NEUCR (Q01371) White collar 1 protein (WC1)| Length = 1167 Score = 28.1 bits (61), Expect = 5.4 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = +3 Query: 150 LRNTHSFYQANNWSPCIMNWDRILLKYGNSLQQPVSSELLFNYQATLCARR*EPDASSFF 329 L+ +S A++W +WD++LL+ + + +S + LF Y + C + E DAS Sbjct: 560 LQQCNSKGVASDWHK--QSWDKMLLENADDVVHVLSLKGLFLYLSPACKKVLEYDASDLV 617 Query: 330 APS 338 S Sbjct: 618 GTS 620
>CATL_DROME (Q95029) Cathepsin L precursor (EC 3.4.22.15) (Cysteine proteinase| 1) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 341 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -3 Query: 297 EHTKLLDS*RAVPMIQAAVNYSHTSTKFYPSSLYKETNC 181 + K+ ++ V + A++ SH S +FY +Y E C Sbjct: 242 DEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQC 280
>CATL_BOVIN (P25975) Cathepsin L precursor (EC 3.4.22.15) [Contains: Cathepsin| L heavy chain; Cathepsin L light chain] Length = 334 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 285 LLDS*RAVPMIQAAVNYSHTSTKFYPSSLYKETNC 181 L+ + V I A++ HTS +FY S +Y + +C Sbjct: 236 LMKAVATVGPISVAIDAGHTSFQFYKSGIYYDPDC 270
>HELI_HCMVA (P16736) Probable ATP-dependent helicase UL105 (EC 3.6.1.-)| Length = 956 Score = 24.3 bits (51), Expect(2) = 6.5 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 309 PDASSFFAPSGLLAQAGAWSG 371 PD SS A + A A AWSG Sbjct: 634 PDVSSLCAAAAATAAAPAWSG 654 Score = 21.9 bits (45), Expect(2) = 6.5 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 125 SLVLGILFLKEYTFFLSGQQLVSLYNEL 208 SLV G+LF Y F++S + EL Sbjct: 601 SLVSGLLFSAMYYFYVSPYTTEEMLREL 628
>VE2_HPV55 (Q80937) Regulatory protein E2| Length = 378 Score = 27.7 bits (60), Expect = 7.0 Identities = 24/89 (26%), Positives = 37/89 (41%), Gaps = 9/89 (10%) Frame = +3 Query: 15 YCRLGPPQQVDVQASMFTHNYVIIQTIN-KSLFVSHPQAW--------YLGFYFLRNTHS 167 YC Q V+V+ N I++ ++ K ++V W Y G Y++ H Sbjct: 108 YCFKKQGQTVEVKYDCNADN--IMEYVSWKYIYVHDTDKWVKVTGHIDYKGLYYVHGGHK 165 Query: 168 FYQANNWSPCIMNWDRILLKYGNSLQQPV 254 Y N +++ KYGNSLQ V Sbjct: 166 TYYTN--------FEKEAKKYGNSLQWEV 186
>MRAW_PSEHT (Q3IFZ6) S-adenosyl-methyltransferase mraW (EC 2.1.1.-)| Length = 312 Score = 27.7 bits (60), Expect = 7.0 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = -3 Query: 372 DLTKPQPGLGDQKEQKRMKHLVLIV-EHTKLLDS*RAVPMIQAAV----NYSHTSTKFY 211 D+T LG++K KR+ H VL V EHT + + + ++ AV + H +T+ + Sbjct: 148 DITHVIKKLGEEKFGKRIAHKVLEVREHTPITTTKQLADLVDEAVPVKDKFKHPATRTF 206
>CATL_CHICK (P09648) Cathepsin L (EC 3.4.22.15) [Contains: Cathepsin L heavy| chain; Cathepsin L light chain] (Fragments) Length = 218 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = -3 Query: 285 LLDS*RAVPMIQAAVNYSHTSTKFYPSSLYKETNC 181 L+ + +V + A++ H+S +FY S +Y E +C Sbjct: 124 LMKAVASVGPVSVAIDAGHSSFQFYQSGIYYEPDC 158
>DADA_PHOLL (Q7N3Z6) D-amino acid dehydrogenase small subunit (EC 1.4.99.1)| Length = 436 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 14/53 (26%) Frame = -2 Query: 295 AHKVA**LKSSSDDTGCCKLFP--------------YFNKILSQFIIQGDQLL 179 AHK+ L+ +D+TG C+LF FNK + Q +++G +++ Sbjct: 183 AHKLTGGLQLPNDETGDCQLFTKELVKMAEAAGVTFLFNKQVKQLLVEGHRII 235 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,780,461 Number of Sequences: 219361 Number of extensions: 1096045 Number of successful extensions: 2718 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 2677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2718 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
