Clone Name | rbastl47d11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ECM29_MOUSE (Q6PDI5) Proteasome-associated protein ECM29 homolog... | 47 | 2e-05 | 2 | ECM29_HUMAN (Q5VYK3) Proteasome-associated protein ECM29 homolog... | 47 | 2e-05 | 3 | ECM29_PONPY (Q5R6J0) Proteasome-associated protein ECM29 homolog... | 47 | 2e-05 | 4 | ECM29_DROME (Q9V677) Proteasome-associated protein ECM29 homolog | 43 | 3e-04 | 5 | ECM29_YEAST (P38737) Proteasome component ECM29 (Extracellular m... | 39 | 0.004 |
---|
>ECM29_MOUSE (Q6PDI5) Proteasome-associated protein ECM29 homolog (Ecm29)| Length = 1840 Score = 46.6 bits (109), Expect = 2e-05 Identities = 21/48 (43%), Positives = 35/48 (72%) Frame = -1 Query: 155 QIQEAFSHLIGDSNELTQDLAPQGMSIVYELGDASMKGQLVHALVNTL 12 +IQ AF ++ +++EL+QD+A +G+ +VYELG+ + +LV LV TL Sbjct: 980 EIQSAFVSVLSENDELSQDVASKGLGLVYELGNEQDQQELVSTLVETL 1027
>ECM29_HUMAN (Q5VYK3) Proteasome-associated protein ECM29 homolog (Ecm29)| Length = 1845 Score = 46.6 bits (109), Expect = 2e-05 Identities = 21/48 (43%), Positives = 35/48 (72%) Frame = -1 Query: 155 QIQEAFSHLIGDSNELTQDLAPQGMSIVYELGDASMKGQLVHALVNTL 12 +IQ AF ++ +++EL+QD+A +G+ +VYELG+ + +LV LV TL Sbjct: 985 EIQSAFVSVLSENDELSQDVASKGLGLVYELGNEQDQQELVSTLVETL 1032
>ECM29_PONPY (Q5R6J0) Proteasome-associated protein ECM29 homolog (Ecm29)| (Fragment) Length = 1810 Score = 46.6 bits (109), Expect = 2e-05 Identities = 21/48 (43%), Positives = 35/48 (72%) Frame = -1 Query: 155 QIQEAFSHLIGDSNELTQDLAPQGMSIVYELGDASMKGQLVHALVNTL 12 +IQ AF ++ +++EL+QD+A +G+ +VYELG+ + +LV LV TL Sbjct: 950 EIQSAFVSVLSENDELSQDVASKGLGLVYELGNEQDQQELVSTLVETL 997
>ECM29_DROME (Q9V677) Proteasome-associated protein ECM29 homolog| Length = 1890 Score = 42.7 bits (99), Expect = 3e-04 Identities = 17/49 (34%), Positives = 32/49 (65%) Frame = -1 Query: 152 IQEAFSHLIGDSNELTQDLAPQGMSIVYELGDASMKGQLVHALVNTLTG 6 +Q AF+ L+ D +E QD+A +G+ +VY + D+ + L ++L++ L G Sbjct: 986 LQFAFTELLSDDSEFVQDVASRGLGLVYSISDSGSQSDLANSLLDQLIG 1034
>ECM29_YEAST (P38737) Proteasome component ECM29 (Extracellular matrix protein 29)| Length = 1868 Score = 38.9 bits (89), Expect = 0.004 Identities = 16/44 (36%), Positives = 27/44 (61%) Frame = -1 Query: 140 FSHLIGDSNELTQDLAPQGMSIVYELGDASMKGQLVHALVNTLT 9 F + D +E QD A +G+S+VYE+G + +K +V L+ + T Sbjct: 997 FMRFLADRDEFIQDSAARGLSLVYEIGGSDLKESMVKGLLKSFT 1040 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,299,449 Number of Sequences: 219361 Number of extensions: 316287 Number of successful extensions: 813 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 813 length of database: 80,573,946 effective HSP length: 27 effective length of database: 74,651,199 effective search space used: 1791628776 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)