Clone Name | rbastl47d08 |
---|---|
Clone Library Name | barley_pub |
>K1210_HUMAN (Q9ULL0) Protein KIAA1210| Length = 1093 Score = 28.9 bits (63), Expect = 3.1 Identities = 22/74 (29%), Positives = 32/74 (43%) Frame = +3 Query: 153 QLFTGHDTVELGSMIAGRKRRLLYPHAASYAANRPSTVTPKQQTSKKF*GKTSLSSSTRP 332 Q+F+ ++ GS +A L P+ S + ++P S K +SS P Sbjct: 587 QIFSESSALKRGSDVAP-----LPPNLPSKSLSKPEVKHQVFSDSGSANPKGGISSKMLP 641 Query: 333 MKRPLLHLGRKAGP 374 MK PL LGR P Sbjct: 642 MKHPLQSLGRPEDP 655
>PTH_IDILO (Q5QV03) Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)| Length = 198 Score = 27.7 bits (60), Expect = 6.9 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 9/54 (16%) Frame = -2 Query: 370 PALRPRCKSGRFMGLVELLRLVLPQNFLEVCCFGVTVLG---------LLAAYD 236 P + + GR+ LR+VLPQNF+ F V L +L AYD Sbjct: 43 PDTKSKALIGRWQQGAHDLRIVLPQNFMNRSGFSVAALANFYKIPANEILVAYD 96
>YHN0_YEAST (P38793) Hypothetical 56.5 kDa protein in DYS1-PCL5 intergenic| region Length = 499 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 Query: 322 ELLRLVLPQNFLEVCCFGVTVLGLLA 245 E+LR VLP+ FLE G T+ G +A Sbjct: 160 EILRAVLPEQFLEEVPTGFTITGHIA 185
>AAA1_RAT (P63116) Asc-type amino acid transporter 1 (Asc-1) (D-serine| transporter) Length = 530 Score = 27.3 bits (59), Expect = 9.1 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -2 Query: 370 PALRPRCKSGRFMGLV-ELLRLVLPQNFLEVCCFGVTVLGLL 248 PAL C + + LV + L+ +F+ C+GVT+LGLL Sbjct: 372 PALLVCCGATAVIMLVGDTYTLINYVSFINYLCYGVTILGLL 413
>AAA1_MOUSE (P63115) Asc-type amino acid transporter 1 (Asc-1) (D-serine| transporter) Length = 530 Score = 27.3 bits (59), Expect = 9.1 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -2 Query: 370 PALRPRCKSGRFMGLV-ELLRLVLPQNFLEVCCFGVTVLGLL 248 PAL C + + LV + L+ +F+ C+GVT+LGLL Sbjct: 372 PALLVCCGATAVIMLVGDTYTLINYVSFINYLCYGVTILGLL 413
>AAA1_HUMAN (Q9NS82) Asc-type amino acid transporter 1 (Asc-1)| Length = 523 Score = 27.3 bits (59), Expect = 9.1 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -2 Query: 370 PALRPRCKSGRFMGLV-ELLRLVLPQNFLEVCCFGVTVLGLL 248 PAL C + + LV + L+ +F+ C+GVT+LGLL Sbjct: 366 PALLVCCGATAVIMLVGDTYTLINYVSFINYLCYGVTILGLL 407 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,156,158 Number of Sequences: 219361 Number of extensions: 1032079 Number of successful extensions: 2291 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2291 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)