Clone Name | rbastl47d05 |
---|---|
Clone Library Name | barley_pub |
>Y13L_BPT4 (P39505) Hypothetical 9.4 kDa protein in nrdB-nrdA intergenic| region Length = 83 Score = 33.1 bits (74), Expect = 0.27 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +1 Query: 172 LHPKYHTFTRIKNKRSIQNTTNLLSMRQQIVHYLPICRHQKKKPNRNNKINYSYKESR 345 L+P Y T + ++ + T +L+S+R + P C H KK N+ N + + Y + + Sbjct: 21 LNPMYGTISPTRDVPHTKETRDLISLRTKQGAEYPPCPHCGKKVNKGNALRWHYDKCK 78
>AT12A_RABIT (Q9TV52) Potassium-transporting ATPase alpha chain 2 (EC 3.6.3.10)| (Proton pump) (Non-gastric H(+)/K(+) ATPase alpha subunit) (HK alpha 2) Length = 1094 Score = 30.0 bits (66), Expect = 2.3 Identities = 16/65 (24%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = +3 Query: 27 WLTFGIKFVAKVGTSVVTIYMRYVAATI*ITCGC----NNLNNKTHESDFVKITPKISHI 194 W+ FGI++V+ S+ +Y+ V A + I G + + F K+ P+ + + Sbjct: 182 WIAFGIQYVSNPSASLDRVYLGTVLAVVVILTGIFAYYQEAKSTNIMASFCKMIPQQAVV 241 Query: 195 YKDQE 209 +D E Sbjct: 242 IRDSE 246
>O10Z1_HUMAN (Q8NGY1) Olfactory receptor 10Z1| Length = 313 Score = 28.5 bits (62), Expect = 6.7 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Frame = -2 Query: 212 LFLILVNV*YFGCNFNKIRLVCFVIQIVAAT----CYSNCCSHITHVNCHNRCANF 57 L L+++ V +F + ++ +++I +A +S C SH+T V H CA+F Sbjct: 202 LSLLVLLVSFFFITISYAYILAAILRIPSAEGQKKAFSTCASHLTVVIIHYGCASF 257
>COL_PIG (P02703) Colipase precursor (Procolipase II)| Length = 112 Score = 28.5 bits (62), Expect = 6.7 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -2 Query: 128 AATCYSNCCSHITHVNCHNRCANFGNEFNTEC 33 +A C SNCC H T ++ +RCA E N+EC Sbjct: 37 SAQCKSNCCQHDTILSL-SRCALKARE-NSEC 66
>TLC2_CHLPN (Q9Z7U0) ADP,ATP carrier protein 2 (ADP/ATP translocase 2)| Length = 540 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 Query: 35 IRY*IRCQSWHICCDNLHALCGCNNLNNMWL 127 + Y C SWH NL L C+ L +WL Sbjct: 212 VAYSFACDSWHSVMLNLTMLITCSGLIMIWL 242
>CXA1_BRARE (O57474) Gap junction alpha-1 protein (Connexin-43) (Cx43) (Short| fin protein) Length = 380 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +1 Query: 280 CRHQKKKPNRNNKINYSYKESR-GRYGETSATSYS 381 CR+ K+ N N NYS +++R G+ G T + S++ Sbjct: 296 CRNYNKQANEQNWANYSTEQNRLGQNGSTISNSHA 330 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,477,694 Number of Sequences: 219361 Number of extensions: 929993 Number of successful extensions: 2308 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2308 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)