Clone Name | rbastl47d03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YBY1_YEAST (P38273) Protein YBR131W | 28 | 7.3 | 2 | COX1_COLPO (O99041) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) ... | 27 | 9.5 | 3 | CRN6_CAEEL (P34508) Cell death-related nuclease 6 precursor (EC ... | 27 | 9.5 |
---|
>YBY1_YEAST (P38273) Protein YBR131W| Length = 704 Score = 27.7 bits (60), Expect = 7.3 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 147 ESKLPAQWISLHFWLDYRAYEISSRFIYFLNASF 248 +S +P Q++S + WL Y RF LN SF Sbjct: 100 QSAIPLQYLSAYLWLSY-------RFFKLLNGSF 126
>COX1_COLPO (O99041) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 514 Score = 27.3 bits (59), Expect = 9.5 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -3 Query: 131 HSRNCKWQLMYIWLTGFPFIVLV 63 H RN KW +W GF F+ V Sbjct: 328 HGRNIKWSPAMLWALGFIFLFTV 350
>CRN6_CAEEL (P34508) Cell death-related nuclease 6 precursor (EC 3.1.-.-)| Length = 378 Score = 27.3 bits (59), Expect = 9.5 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +3 Query: 144 IESKLPAQWISLHFWLDYRAYEISSRFI 227 ++S + A++I L + +DY +YE S+F+ Sbjct: 274 VQSTMSAKYIRLPYAIDYSSYEDHSKFV 301 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,636,752 Number of Sequences: 219361 Number of extensions: 961918 Number of successful extensions: 1991 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1975 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1991 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)