Clone Name | rbastl47c12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LCYB_NARPS (Q40424) Lycopene beta cyclase, chloroplast precursor... | 32 | 0.54 | 2 | GOX2_ARATH (Q9LRR9) Probable peroxisomal (S)-2-hydroxy-acid oxid... | 30 | 1.2 | 3 | GOX1_ARATH (Q9LRS0) Probable peroxisomal (S)-2-hydroxy-acid oxid... | 30 | 1.2 | 4 | TECTA_CHICK (Q9YH85) Alpha-tectorin precursor | 29 | 2.7 | 5 | CSPG3_PANTR (Q5IS41) Neurocan core protein precursor (Chondroiti... | 28 | 7.8 |
---|
>LCYB_NARPS (Q40424) Lycopene beta cyclase, chloroplast precursor (EC 1.14.-.-)| Length = 503 Score = 31.6 bits (70), Expect = 0.54 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Frame = +1 Query: 22 IRTLMFA*PDQSTML*FEPTKITIR---KFPSYREPLLQQLDYAPATISSLEEAQRCTAP 192 I T ++A P S + E T + R K +E ++ +L++ I S+EE +RC P Sbjct: 283 IPTFLYAMPFSSNRIFLEETSLVARPGLKMEDIQERMVARLNHLGIRIKSIEEDERCVIP 342
>GOX2_ARATH (Q9LRR9) Probable peroxisomal (S)-2-hydroxy-acid oxidase 2 (EC| 1.1.3.15) (Glycolate oxidase 2) (GOX 2) (Short chain alpha-hydroxy acid oxidase 2) Length = 367 Score = 30.4 bits (67), Expect = 1.2 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +1 Query: 127 QQLDYAPATISSLEEAQRCT 186 +QLDY PATIS+LEE + T Sbjct: 257 RQLDYVPATISALEEVVKAT 276
>GOX1_ARATH (Q9LRS0) Probable peroxisomal (S)-2-hydroxy-acid oxidase 1 (EC| 1.1.3.15) (Glycolate oxidase 1) (GOX 1) (Short chain alpha-hydroxy acid oxidase 1) Length = 367 Score = 30.4 bits (67), Expect = 1.2 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +1 Query: 127 QQLDYAPATISSLEEAQRCT 186 +QLDY PATIS+LEE + T Sbjct: 257 RQLDYVPATISALEEVVKAT 276
>TECTA_CHICK (Q9YH85) Alpha-tectorin precursor| Length = 2120 Score = 29.3 bits (64), Expect = 2.7 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 145 PATISSLEEAQRCTAPCP 198 PAT S L RCTAPCP Sbjct: 591 PATCSDLTAPLRCTAPCP 608
>CSPG3_PANTR (Q5IS41) Neurocan core protein precursor (Chondroitin sulfate| proteoglycan 3) Length = 1321 Score = 27.7 bits (60), Expect = 7.8 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +1 Query: 103 PSYREPLLQQLDYAPATISSLEEAQRCTAPCPSSSILFS 219 P ++EPL+ + P + +E+Q+ +P P +L S Sbjct: 402 PDFQEPLVSSGEEEPLILEEKQESQQTLSPTPGDPMLAS 440 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,872,334 Number of Sequences: 219361 Number of extensions: 852705 Number of successful extensions: 2169 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2169 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)