| Clone Name | rbastl47c06 |
|---|---|
| Clone Library Name | barley_pub |
>C8AP2_MOUSE (Q9WUF3) CASP8-associated protein 2 (FLICE-associated huge protein)| Length = 1962 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = +3 Query: 279 PGYVILHEESK--FIIIIRNALPSLTAGIRHRIIA 377 P + ++ E+S FI+ IR A PS + G++H ++A Sbjct: 1507 PMHAVIMEKSNDHFIVKIRRATPSTSPGLKHGVVA 1541
>Y1227_METJA (Q58624) Hypothetical protein MJ1227| Length = 240 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 161 GMQLISSYPLPKYISEFLFLFSCQTK-PYCH 250 G+ +S+ PK S +FL+ C K PYCH Sbjct: 7 GIVDLSTIDYPKKASAVIFLYGCNMKCPYCH 37
>SHS1_YEAST (Q07657) Seventh homolog of septin 1 (Septation protein 7)| Length = 551 Score = 28.9 bits (63), Expect = 3.1 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Frame = +2 Query: 65 FSSNISEYKNVPATFSY-----YLQSNDQRKLMLPPLGMQLISSYPLPKYISEF 211 F++N+ E K P + Y + SN + K++ P + S +P Y+SEF Sbjct: 39 FANNLLETKIFPHKYQYGKSNASISSNPEVKVIAPTKVVSFNSKNGIPSYVSEF 92
>HMRM_HAEIN (P45272) Multidrug resistance protein hmrM (Na(+)/drug antiporter)| (Multidrug-efflux transporter) Length = 464 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 143 LMLPPLGMQLISSYPLPKYISEFLFLF 223 LML PLG +++S+ + S F+F+F Sbjct: 266 LMLSPLGATIVASHQITLNTSSFIFMF 292
>DCR1_CAEEL (P34529) Endoribonuclease dcr-1 (EC 3.1.26.-)| Length = 1845 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 371 DTVPYSSSKRGKSIPDDDDEL*FFMENYISR 279 DTV + +I D+DDEL F M +Y +R Sbjct: 1069 DTVGLTQGLHDGNISDEDDELPFVMHDYTAR 1099
>SODM_CHAFE (O96347) Superoxide dismutase [Mn], mitochondrial precursor (EC| 1.15.1.1) Length = 224 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +2 Query: 110 SYYLQSNDQRKLMLPPLGMQLISSYPLPKYISEFLFLFSC 229 +YYLQ + R++ML P G+ LI L + + SC Sbjct: 182 AYYLQYKNVRRIMLKPSGISLIGRISLQGSMQQSKNATSC 221 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,734,544 Number of Sequences: 219361 Number of extensions: 1143250 Number of successful extensions: 2473 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2473 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)