Clone Name | rbastl47c03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RDRP_ROTPG (P17699) RNA-directed RNA polymerase subunit VP1 (EC ... | 28 | 5.1 |
---|
>RDRP_ROTPG (P17699) RNA-directed RNA polymerase subunit VP1 (EC 2.7.7.48)| (Inner layer protein VP1) (Core protein VP1) Length = 1088 Score = 28.5 bits (62), Expect = 5.1 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +1 Query: 19 RLPILKASNSQLLI*CYK*SVVCIDNNGQGFCRWHQGEEEKELVSQITDLSM 174 ++PI +SN +L C C+DN+ +G EE K+++ T LS+ Sbjct: 23 QIPIYYSSNPELEKRCIDFHAKCVDNSKKGLSLKPLFEEYKDVIDNATLLSI 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,459,921 Number of Sequences: 219361 Number of extensions: 354005 Number of successful extensions: 727 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 727 length of database: 80,573,946 effective HSP length: 40 effective length of database: 71,799,506 effective search space used: 1723188144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)