Clone Name | rbastl47b08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IPDE_DICDI (P22549) Cyclic nucleotide phosphodiesterase inhibito... | 28 | 7.2 | 2 | UBP44_HUMAN (Q9H0E7) Ubiquitin carboxyl-terminal hydrolase 44 (E... | 27 | 9.3 | 3 | NU4C_HORVU (O03060) NAD(P)H-quinone oxidoreductase chain 4, chlo... | 27 | 9.3 |
---|
>IPDE_DICDI (P22549) Cyclic nucleotide phosphodiesterase inhibitor precursor| (PDI) Length = 237 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 198 WCYSLYGV*CCIARLRCS*KVPCKIKQD 281 +C +LYG C + CS KVPC I D Sbjct: 169 YCSTLYG--CYHEPIECSIKVPCNIDSD 194
>UBP44_HUMAN (Q9H0E7) Ubiquitin carboxyl-terminal hydrolase 44 (EC 3.1.2.15)| (Ubiquitin thioesterase 44) (Ubiquitin-specific-processing protease 44) (Deubiquitinating enzyme 44) Length = 712 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = -3 Query: 219 HHTDCNTIQTVCACVACLDXXXXXXXGQTCLFMLKSSKH 103 H DCNT +++ AC++C + L + S H Sbjct: 28 HCVDCNTTESIWACLSCSHVACGRYIEEHALKHFQESSH 66
>NU4C_HORVU (O03060) NAD(P)H-quinone oxidoreductase chain 4, chloroplast (EC| 1.6.5.-) (NAD(P)H dehydrogenase, chain 4) (NADH-plastoquinone oxidoreductase chain 4) Length = 500 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +1 Query: 16 LRSLGTYNLHNHNMKTQPLGHYSFYPCITMLRRFQHEQTSLAS 144 L +G Y L NM+ P HY F P + ++ Q +L S Sbjct: 253 LLKMGAYGLIRINMELLPHAHYLFSPWLVIIGAIQIIYAALTS 295 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,567,432 Number of Sequences: 219361 Number of extensions: 807591 Number of successful extensions: 1361 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1361 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)