Clone Name | rbastl47b02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UVH1_ARATH (Q9LKI5) DNA repair endonuclease UVH1 (EC 3.1.-.-) (U... | 33 | 0.14 | 2 | POLO_DROME (P52304) Serine/threonine-protein kinase polo (EC 2.7... | 32 | 0.32 | 3 | POLG_PYFV1 (Q05057) Genome polyprotein [Contains: Putative leade... | 28 | 4.6 | 4 | ATM_DEBHA (Q6BV76) Serine/threonine-protein kinase TEL1 (EC 2.7.... | 28 | 7.8 |
---|
>UVH1_ARATH (Q9LKI5) DNA repair endonuclease UVH1 (EC 3.1.-.-) (Ultraviolet| hypersensitive 1) (AtRAD1) (DNA excision repair protein XP-F homolog) Length = 956 Score = 33.5 bits (75), Expect = 0.14 Identities = 14/24 (58%), Positives = 20/24 (83%) Frame = -1 Query: 287 ELMGSQKGARTLKEFLDAKCPSMI 216 ELMG K A++L+EFLDAK P+++ Sbjct: 933 ELMGGHKVAKSLREFLDAKYPTLL 956
>POLO_DROME (P52304) Serine/threonine-protein kinase polo (EC 2.7.11.21)| Length = 576 Score = 32.3 bits (72), Expect = 0.32 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 22 GIGFGWNSTTQLTVLLTQCDIDYTSK*PSPTYLTSTAY 135 GIG +N TT+L +L Q ++ + K TY+T+T Y Sbjct: 412 GIGVMFNDTTKLILLPNQINVHFIDKDGKETYMTTTDY 449
>POLG_PYFV1 (Q05057) Genome polyprotein [Contains: Putative leader protein;| Coat protein 1 (22.5 kDa protein) (CP-1); Coat protein 2 (26 kDa protein) (CP-2); Coat protein 3 (31 kDa protein) (CP-3); Putative helicase (EC 3.6.1.-) (Putative NTP-binding prot Length = 3027 Score = 28.5 bits (62), Expect = 4.6 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 4/71 (5%) Frame = +2 Query: 14 TYLALDLDGIQLPN*QSSLHNVISITLANSLALLT*QVQRI*TPIVQRNSSSK----TSL 181 T A D DGI++P S+H +S +NS L+ R+ TP+ + SS T Sbjct: 505 TVFAKDSDGIKIPIEFMSIHKAVSAHDSNSHNALSRVEARVVTPLSHISLSSPVLSITIQ 564 Query: 182 HLTRTVKVDAM 214 + VK D M Sbjct: 565 VFAKNVKADYM 575
>ATM_DEBHA (Q6BV76) Serine/threonine-protein kinase TEL1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase TEL1) (Telomere length regulation protein 1) (ATM homolog) Length = 2948 Score = 27.7 bits (60), Expect = 7.8 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 9/70 (12%) Frame = +2 Query: 68 LHNVISITLANSLALLT*QVQRI*TPIVQRNSSSKT----SLHLTR-----TVKVDAMRS 220 LH++I NS+A++ ++Q++ IV N SKT S HL R K R+ Sbjct: 2177 LHDLIRY---NSIAIIAKELQKLVNSIVMINEISKTKFSESDHLLRDSISQLTKYQIART 2233 Query: 221 CWDTWHPETP 250 W H P Sbjct: 2234 LWQQGHTSIP 2243 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,412,686 Number of Sequences: 219361 Number of extensions: 634259 Number of successful extensions: 1187 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1187 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)