Clone Name | rbastl47b01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LY6E_CHICK (Q90986) Lymphocyte antigen Ly-6E precursor (Stem cel... | 31 | 1.1 | 2 | MTAL2_PICAN (Q707Y8) Mating-type protein ALPHA2 (MATalpha2 trans... | 30 | 3.2 | 3 | CCSA_CYACA (O19901) Cytochrome c biogenesis protein ccsA | 28 | 9.4 |
---|
>LY6E_CHICK (Q90986) Lymphocyte antigen Ly-6E precursor (Stem cell antigen 2)| (SCA-2) Length = 126 Score = 31.2 bits (69), Expect = 1.1 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = -2 Query: 426 EKTGNHLCFKCSSATSNFGANCCTISKCTILPSIVANHCTNEHHCLT 286 E+ +CF CS A+SN+ C T KC NE HC+T Sbjct: 16 ERAHTLICFSCSDASSNWA--CLTPVKC----------AENEEHCVT 50
>MTAL2_PICAN (Q707Y8) Mating-type protein ALPHA2 (MATalpha2 transcription| factor) Length = 163 Score = 29.6 bits (65), Expect = 3.2 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 142 DKTVAIQKELCFHISQDTRLPPNDI 216 ++T+ I KEL ++QDTR PND+ Sbjct: 138 ERTLTISKELSDLLNQDTRCSPNDV 162
>CCSA_CYACA (O19901) Cytochrome c biogenesis protein ccsA| Length = 293 Score = 28.1 bits (61), Expect = 9.4 Identities = 25/104 (24%), Positives = 43/104 (41%), Gaps = 12/104 (11%) Frame = -1 Query: 403 LQVLISHKQLRSKLLYNKQVYYFAF--HC---GQSLYK*APLSNCTRTHHQKLVNLLQNL 239 L L+S +KL Y KQ+ F+ C + L C R + L NL ++L Sbjct: 18 LGALVSSLFYWAKLTYYKQIQVFSLPKFCLIFSNCIIAGMLLERCFRYSYFPLSNLYESL 77 Query: 238 PSVSWAVKC-------HLAVVSCLAICENTILFGWQLFCLPSLL 128 +SW + L+++ + T++ G+ + LP L Sbjct: 78 LFLSWVLNIITIIFVDKLSIIGAIGSSAVTLIIGYANYILPPSL 121 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,070,868 Number of Sequences: 219361 Number of extensions: 1053092 Number of successful extensions: 2193 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2193 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)