Clone Name | rbastl47a03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FABP5_CAEEL (O01814) Fatty acid-binding protein homolog 5 | 33 | 0.18 | 2 | SODM_THEAQ (P53653) Superoxide dismutase [Mn] (EC 1.15.1.1) | 28 | 4.5 | 3 | TRK1_SACBA (P28569) High-affinity potassium transport protein | 28 | 4.5 | 4 | Y037_MYCPN (P75077) Hypothetical protein MPN037 (B01_orf147) | 28 | 7.7 |
---|
>FABP5_CAEEL (O01814) Fatty acid-binding protein homolog 5| Length = 136 Score = 33.1 bits (74), Expect = 0.18 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +2 Query: 2 DMLRNISNLFTLANASCTRQPLCGGGLRIRDNAHRMHTQQLSTDKNTTV 148 D L+ + L A+C +P L I+ N ++ H QLST KNTT+ Sbjct: 20 DYLKEVGVGLLLRKAACAAKPT----LEIKVNGNKWHVNQLSTFKNTTL 64
>SODM_THEAQ (P53653) Superoxide dismutase [Mn] (EC 1.15.1.1)| Length = 203 Score = 28.5 bits (62), Expect = 4.5 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +1 Query: 106 DAHPAAKHRQEHHGGTVNQLN-IIERTKETLAHIVERELRTMTRLICQVQ 252 DA H Q+HHG V LN +E+ VE LR +T L +Q Sbjct: 21 DARTMEIHHQKHHGAYVTNLNAALEKYPYLQGAEVETLLRHLTALPADIQ 70
>TRK1_SACBA (P28569) High-affinity potassium transport protein| Length = 1241 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 89 RDNAHRMHTQQLSTDKNTTVAPLTSS 166 RDN+HR ++ +S+D N T PL + Sbjct: 675 RDNSHRNGSEDVSSDSNETTYPLNGN 700
>Y037_MYCPN (P75077) Hypothetical protein MPN037 (B01_orf147)| Length = 147 Score = 27.7 bits (60), Expect = 7.7 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 275 SRWNQLMRWTWQISLVMVRSSL-STMWASVSFVRSIILSWL 156 S W+ L+ W W I+ + RS+L ST W I+ +WL Sbjct: 19 STWSSLICWPWTITTSVSRSTLSSTTW--------ILWTWL 51 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,513,000 Number of Sequences: 219361 Number of extensions: 935911 Number of successful extensions: 2820 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2819 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)