Clone Name | rbastl46h09 |
---|---|
Clone Library Name | barley_pub |
>SND1_RAT (Q66X93) Staphylococcal nuclease domain-containing protein 1 (p100| co-activator) (100 kDa coactivator) (SND p102) (p105 coactivator) Length = 909 Score = 30.8 bits (68), Expect = 0.80 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 376 QEKAKKERLRLWQYGDVESD 317 QE AK RL LW+YGD +D Sbjct: 881 QESAKSARLNLWRYGDFRAD 900
>SND1_MOUSE (Q78PY7) Staphylococcal nuclease domain-containing protein 1 (p100| co-activator) (100 kDa coactivator) Length = 910 Score = 30.8 bits (68), Expect = 0.80 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 376 QEKAKKERLRLWQYGDVESD 317 QE AK RL LW+YGD +D Sbjct: 882 QESAKSARLNLWRYGDFRAD 901
>SND1_HUMAN (Q7KZF4) Staphylococcal nuclease domain-containing protein 1 (p100| co-activator) (100 kDa coactivator) (EBNA2 coactivator p100) Length = 910 Score = 30.8 bits (68), Expect = 0.80 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 376 QEKAKKERLRLWQYGDVESD 317 QE AK RL LW+YGD +D Sbjct: 882 QESAKSARLNLWRYGDFRAD 901
>SND1_BOVIN (Q863B3) Staphylococcal nuclease domain-containing protein 1 (p100| co-activator) (100 kDa coactivator) Length = 910 Score = 30.8 bits (68), Expect = 0.80 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 376 QEKAKKERLRLWQYGDVESD 317 QE AK RL LW+YGD +D Sbjct: 882 QESAKSARLNLWRYGDFRAD 901
>NADB2_RALSO (Q8XQG4) L-aspartate oxidase 2 (EC 1.4.3.16) (LASPO 2) (Quinolinate| synthetase B 2) Length = 536 Score = 30.4 bits (67), Expect = 1.0 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +1 Query: 256 CLLSSTDAAGVSSRLELALPRRIQ 327 C S TD AG +SRL L LP RI+ Sbjct: 396 CAQSVTDTAGSASRLRLTLPERIE 419
>URED_SYNY3 (P73047) Urease accessory protein ureD| Length = 270 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -1 Query: 281 AASVDERRQWHAQSWFRYESFGHRAKLSRELI*KLSKKERLY 156 A++V+ W A W RY+ GHR ++ L+ K +R + Sbjct: 4 ASTVNPSAPWQANLWLRYDRPGHRTRMVECLVQAPLKVQRSF 45
>SYK2_MYCTU (P94974) Putative lysyl-tRNA synthetase 2 (EC 6.1.1.6)| (Lysine--tRNA ligase 2) (LysRS 2) Length = 1172 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 54 VLPLQRRNAVHKGHRP 101 VLP RRN VH GH P Sbjct: 628 VLPFSRRNRVHTGHHP 643
>SYK2_MYCBO (Q7VEV7) Putative lysyl-tRNA synthetase 2 (EC 6.1.1.6)| (Lysine--tRNA ligase 2) (LysRS 2) Length = 1172 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 54 VLPLQRRNAVHKGHRP 101 VLP RRN VH GH P Sbjct: 628 VLPFSRRNRVHTGHHP 643
>DYN1_MOUSE (P39053) Dynamin-1 (EC 3.6.5.5)| Length = 867 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -3 Query: 348 ACGSMETLNPTRKSKLQAGGDPRRVGRREKA 256 AC + E ++ + S L+AG P RVG +EKA Sbjct: 606 ACETQEEVDSWKASFLRAGVYPERVGDKEKA 636
>DYN1_HUMAN (Q05193) Dynamin-1 (EC 3.6.5.5)| Length = 864 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -3 Query: 348 ACGSMETLNPTRKSKLQAGGDPRRVGRREKA 256 AC + E ++ + S L+AG P RVG +EKA Sbjct: 606 ACETQEEVDSWKASFLRAGVYPERVGDKEKA 636
>DYN1_RAT (P21575) Dynamin-1 (EC 3.6.5.5) (D100) (Dynamin, brain) (B-dynamin)| Length = 851 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -3 Query: 348 ACGSMETLNPTRKSKLQAGGDPRRVGRREKA 256 AC + E ++ + S L+AG P RVG +EKA Sbjct: 606 ACETQEEVDSWKASFLRAGVYPERVGDKEKA 636
>Y1356_MYCBO (P64806) Hypothetical protein Mb1356| Length = 98 Score = 28.1 bits (61), Expect = 5.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 290 ETPAASVDERRQWHAQSW 237 + P A VD+RR WH W Sbjct: 68 DLPQAGVDDRRHWHTPCW 85
>Y1322_MYCTU (P64805) Hypothetical protein Rv1322/MT1363.1| Length = 98 Score = 28.1 bits (61), Expect = 5.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 290 ETPAASVDERRQWHAQSW 237 + P A VD+RR WH W Sbjct: 68 DLPQAGVDDRRHWHTPCW 85
>SETB2_HUMAN (Q96T68) Probable histone-lysine N-methyltransferase, H3 lysine-9| specific (EC 2.1.1.43) (Histone H3-K9 methyltransferase) (H3-K9-HMTase) (SET domain bifurcated 2) (Chronic lymphocytic leukemia deletion region gene 8 protein) Length = 719 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +1 Query: 223 LSYLNHDCACHCLLSSTDAAGVSSRLELALPRRIQRLHTATGA 351 LSY +HDC+ CL+ + L+L + QR H T + Sbjct: 140 LSYQSHDCSGACLMKMPLNLKGENPLQLPIKCHFQRRHAKTNS 182
>POLG_TMEVB (P08544) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2303 Score = 27.3 bits (59), Expect = 8.9 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = +3 Query: 258 PSLVYRRGG-GLLPPG---ACXXXXXXXXPYCHRRSLSFFAFSWNCSRFSRAVF 407 P L +R G GL P G C P+ RSL F+ CS FS +++ Sbjct: 951 PVLTFRIPGFGLTPAGRMLVCMGEQPAHGPFTSSRSLYHVIFTATCSSFSFSIY 1004
>POLG_TMEVD (P13899) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2301 Score = 27.3 bits (59), Expect = 8.9 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = +3 Query: 258 PSLVYRRGG-GLLPPG---ACXXXXXXXXPYCHRRSLSFFAFSWNCSRFSRAVF 407 P L +R G GL P G C P+ RSL F+ CS FS +++ Sbjct: 949 PVLTFRIPGFGLTPAGRMLVCMGEKPAHGPFTSSRSLYHVIFTATCSSFSFSIY 1002
>N4BM_HUMAN (O95298) NADH-ubiquinone oxidoreductase subunit B14.5b (EC 1.6.5.3)| (EC 1.6.99.3) (Complex I-B14.5b) (CI-B14.5b) Length = 119 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = -2 Query: 178 LVRKRDYIYAIRRRELY 128 LV++ DY+YA+R RE++ Sbjct: 74 LVKREDYLYAVRDREMF 90 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,898,802 Number of Sequences: 219361 Number of extensions: 874240 Number of successful extensions: 2537 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 2472 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2537 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)