Clone Name | rbastl46h07 |
---|---|
Clone Library Name | barley_pub |
>CWF19_SCHPO (Q09909) Cell cycle control protein cwf19| Length = 639 Score = 33.9 bits (76), Expect = 0.10 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 198 NQTGCETFHPGTENHHHSRHGNPGHPCHFGTHRPA 302 N+T ET H HHHSRH H H + RP+ Sbjct: 16 NETDRETNHSRRHRHHHSRHRESKHGRHDRSERPS 50
>SEPP1_RAT (P25236) Selenoprotein P precursor (SeP) [Contains: Selenoprotein| Se-P10; Selenoprotein Se-P6; Selenoprotein Se-P2; Selenoprotein Se-P1] Length = 385 Score = 31.6 bits (70), Expect = 0.50 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 204 TGCETFHPGTENHHHSRHGNPGHPCHFGTHRPAQS 308 T +T P E++HH H GH H G+ +P+++ Sbjct: 193 TASKTTEPSEEHNHHKHHDKHGHE-HLGSSKPSEN 226
>HRPX_PLALO (P04929) Histidine-rich glycoprotein precursor| Length = 351 Score = 29.3 bits (64), Expect = 2.5 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +3 Query: 174 HCHPL*TRNQTGCETFHPGTENHHHSRHGNPGHPCHFGTHRPAQSLLCQHSQTSH 338 H HP E H HHH H P H H G H H H Sbjct: 79 HHHPEEHHEPHHEEHHHHHPHPHHHHHHHPPHHHHHLGHHHHHHHAAHHHHHEEH 133 Score = 27.3 bits (59), Expect = 9.4 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 222 HPGTENHHHSRHGNPGHPCHFGTH 293 H G +HHH HG+ H H H Sbjct: 221 HHGHHHHHHHHHGHHHHHHHHHGH 244
>CAUP_DROME (P54269) Homeobox protein caupolican| Length = 693 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/55 (25%), Positives = 20/55 (36%) Frame = +3 Query: 126 YQTSNFYRACLGSPCVHCHPL*TRNQTGCETFHPGTENHHHSRHGNPGHPCHFGT 290 Y NFY + PL Q + ++HHH H +P H G+ Sbjct: 480 YLGQNFYPPSSADQQLPHQPLQQHQQQQLQQLQQQQQHHHHPHHHHPHHSMELGS 534
>GSC_DROME (P54366) Homeobox protein goosecoid| Length = 419 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 228 GTENHHHSRHGNPGHPCHFGTHRPAQ 305 G +H H HG+P HP H G H Q Sbjct: 247 GHGHHPHHPHGHPHHP-HLGAHHHGQ 271
>ERC2_MOUSE (Q6PH08) ERC protein 2 (CAZ-associated structural protein 1) (CAST1)| Length = 957 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 213 ETFHPGTENHHHSRHGNPGHPCHFGTHRPA 302 E H +HHH H +PG H HRP+ Sbjct: 918 EDHHHYHHHHHHHHHRSPGRSQH-SNHRPS 946
>LRCH1_HUMAN (Q9Y2L9) Leucine-rich repeats and calponin homology| domain-containing protein 1 (Calponin homology domain-containing protein 1) (Neuronal protein 81) (NP81) Length = 728 Score = 27.7 bits (60), Expect = 7.2 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +3 Query: 222 HPGTENHHHSRHGNPGHP 275 HP +HHH HG G P Sbjct: 25 HPHHHHHHHQHHGGTGAP 42
>YDH3_PLAFS (P14589) Hypothetical protein 3' to Asp-rich and His-rich proteins| (Fragment) Length = 53 Score = 27.7 bits (60), Expect = 7.2 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -3 Query: 328 WLCWQRRLWAGRW 290 W CW+RR W RW Sbjct: 13 WWCWRRRGWRRRW 25
>Y2392_ARCFU (O30279) Hypothetical protein AF2392| Length = 86 Score = 27.7 bits (60), Expect = 7.2 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = -3 Query: 292 WVPK*QGWPGFPWRLWWWF---SVPGW 221 W+P GW G WR WW+ +PGW Sbjct: 4 WMP---GWGGRGWR--WWYRATGLPGW 25
>POU23_BRARE (P79745) POU domain protein ZP-23| Length = 443 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 195 RNQTGCETFHPGTENHHHSRHGNPGHPCHFG 287 +N +G + H GT HH + H P H H G Sbjct: 119 KNNSGRDDLHSGTALHHRAPHLGP-HQTHAG 148
>PKNA2_BIFLO (Q8G4G1) Probable serine/threonine-protein kinase pknA2 (EC| 2.7.11.1) Length = 757 Score = 27.3 bits (59), Expect = 9.4 Identities = 9/16 (56%), Positives = 11/16 (68%), Gaps = 2/16 (12%) Frame = -3 Query: 247 WWWFSVPG--WKVSQP 206 WWWF+ PG W V +P Sbjct: 445 WWWFAGPGSYWSVPKP 460 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,354,199 Number of Sequences: 219361 Number of extensions: 886531 Number of successful extensions: 3013 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2970 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)