| Clone Name | rbastl46h01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2 | 71 | 1e-12 | 2 | UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1 | 71 | 1e-12 | 3 | UBE13_WHEAT (P31252) Ubiquitin-activating enzyme E1 3 | 61 | 1e-09 | 4 | FUT4_BOVIN (Q8HZR3) Alpha-(1,3)-fucosyltransferase (EC 2.4.1.-) ... | 31 | 1.6 | 5 | SENP7_HUMAN (Q9BQF6) Sentrin-specific protease 7 (EC 3.4.22.-) (... | 30 | 2.0 | 6 | UVRC_RALSO (Q8Y0H3) UvrABC system protein C (Protein uvrC) (Exci... | 30 | 3.5 | 7 | XERD_RICPR (Q9ZDG8) Tyrosine recombinase xerD | 30 | 3.5 |
|---|
>UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2| Length = 1051 Score = 70.9 bits (172), Expect = 1e-12 Identities = 38/52 (73%), Positives = 38/52 (73%) Frame = -2 Query: 444 HKERLDRKVVDVAREVAKMEVPSYRRHLXXXXXXXXXXXXXXDIPLVSVYFR 289 HKERLDRKVVDVAREVAKMEVPSYRRHL DIPLVSVYFR Sbjct: 1000 HKERLDRKVVDVAREVAKMEVPSYRRHLDVVVACEDDDDNDVDIPLVSVYFR 1051
>UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1| Length = 1051 Score = 70.9 bits (172), Expect = 1e-12 Identities = 38/52 (73%), Positives = 38/52 (73%) Frame = -2 Query: 444 HKERLDRKVVDVAREVAKMEVPSYRRHLXXXXXXXXXXXXXXDIPLVSVYFR 289 HKERLDRKVVDVAREVAKMEVPSYRRHL DIPLVSVYFR Sbjct: 1000 HKERLDRKVVDVAREVAKMEVPSYRRHLDVVVACEDDDDNDVDIPLVSVYFR 1051
>UBE13_WHEAT (P31252) Ubiquitin-activating enzyme E1 3| Length = 1053 Score = 61.2 bits (147), Expect = 1e-09 Identities = 31/52 (59%), Positives = 36/52 (69%) Frame = -2 Query: 444 HKERLDRKVVDVAREVAKMEVPSYRRHLXXXXXXXXXXXXXXDIPLVSVYFR 289 HK+RL +KVVD+AREVAK++VP YRRHL DIPLVSVYFR Sbjct: 1002 HKDRLTKKVVDIAREVAKVDVPEYRRHLDIGVACEDEDENDVDIPLVSVYFR 1053
>FUT4_BOVIN (Q8HZR3) Alpha-(1,3)-fucosyltransferase (EC 2.4.1.-) (Galactoside| 3-L-fucosyltransferase) (Fucosyltransferase 4) (FUCT-IV) (Fuc-TIV) Length = 398 Score = 30.8 bits (68), Expect = 1.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 378 RAPPSWPPPWQHQLP 422 + PP WPPPW Q+P Sbjct: 112 KGPPDWPPPWGVQMP 126
>SENP7_HUMAN (Q9BQF6) Sentrin-specific protease 7 (EC 3.4.22.-)| (Sentrin/SUMO-specific protease SENP7) (SUMO-1-specific protease 2) Length = 984 Score = 30.4 bits (67), Expect = 2.0 Identities = 21/83 (25%), Positives = 36/83 (43%) Frame = +1 Query: 196 QLTVTNATHDLSVDQA*PTTRSCEHR*SASSAEVDRHKRDVDIVVIVILTGHHDVEMTPV 375 +LT++NAT S + S+ E + +DIV I L + E+ + Sbjct: 309 ELTLSNATKSAS---------------AGSTTETVEYSNSIDIVGISSLVEKDENELNTI 353 Query: 376 RGHLHLGHLPGNINYLSVKPFLV 444 + GH GN + +S +P +V Sbjct: 354 EKPILRGHNEGNQSLISAEPIVV 376
>UVRC_RALSO (Q8Y0H3) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 654 Score = 29.6 bits (65), Expect = 3.5 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 313 DVDIVVIVILTGHHDVEMTPVRGHLHLG 396 D+DI+ + I GH V + VRG HLG Sbjct: 268 DIDILAVAIKGGHACVNLAMVRGGRHLG 295
>XERD_RICPR (Q9ZDG8) Tyrosine recombinase xerD| Length = 311 Score = 29.6 bits (65), Expect = 3.5 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 319 DIVVIVILTGHHDVEMTPVRGHLHLGHL 402 D+ VI L GH D+ T + HLH HL Sbjct: 267 DLRVIQELLGHADISTTQIYTHLHTNHL 294 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,333,158 Number of Sequences: 219361 Number of extensions: 1088873 Number of successful extensions: 2800 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2800 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)