ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl46f11 |
|---|---|
| Clone Library Name | barley_pub |
>LONH2_MAIZE (P93648) Lon protease homolog 2, mitochondrial precursor (EC| 3.4.21.-) Length = 964 Score = 67.0 bits (162), Expect = 2e-11 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 2/41 (4%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIYKLAFQNE--TETS 297 NKRDFDELA NVKEGL+VHFVDTY+EIY LAFQ++ TETS Sbjct: 924 NKRDFDELASNVKEGLEVHFVDTYSEIYDLAFQSDAGTETS 964
>LONH4_ARATH (Q9M9L7) Putative Lon protease homolog 4, mitochondrial precursor (EC| 3.4.21.-) Length = 942 Score = 55.5 bits (132), Expect = 5e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIYKLAF 318 N+RDFDELA NVKEGL+VHFVD Y +I++LAF Sbjct: 907 NRRDFDELARNVKEGLEVHFVDEYEQIFELAF 938
>LONH2_ARATH (P93655) Lon protease homolog 2, mitochondrial precursor (EC| 3.4.21.-) Length = 940 Score = 55.1 bits (131), Expect = 6e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIYKLAF 318 N+RDFDELA NVKEGL+VHFVD Y +I++LAF Sbjct: 902 NRRDFDELAENVKEGLNVHFVDDYGKIFELAF 933
>LONH3_ARATH (Q9M9L8) Putative Lon protease homolog 3, mitochondrial precursor| (EC 3.4.21.-) Length = 924 Score = 53.5 bits (127), Expect = 2e-07 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIYKLAF 318 N+RDF+ELA N+KEGLDVHFVD Y +I+ LAF Sbjct: 889 NRRDFEELAENMKEGLDVHFVDEYEKIFDLAF 920
>LONM_HUMAN (P36776) Lon protease homolog, mitochondrial precursor (EC 3.4.21.-)| (Lon protease-like protein) (LONP) (LONHs) Length = 959 Score = 44.7 bits (104), Expect = 9e-05 Identities = 19/35 (54%), Positives = 27/35 (77%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIYKLAFQNE 309 NK+DF +LA + EGL+VHFV+ Y EI+ +AF +E Sbjct: 916 NKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPDE 950
>LON_CHLTR (O84348) ATP-dependent protease La (EC 3.4.21.53)| Length = 819 Score = 43.5 bits (101), Expect = 2e-04 Identities = 17/32 (53%), Positives = 26/32 (81%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIYKLAF 318 N+RD+DEL +K+GL VHFV Y++++K+AF Sbjct: 785 NRRDYDELPAYLKKGLKVHFVTHYDDVFKIAF 816
>LON_CHLMU (Q9PK50) ATP-dependent protease La (EC 3.4.21.53)| Length = 819 Score = 43.5 bits (101), Expect = 2e-04 Identities = 17/32 (53%), Positives = 26/32 (81%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIYKLAF 318 N+RD+DEL +K+GL VHFV Y++++K+AF Sbjct: 785 NRRDYDELPAYLKKGLKVHFVTHYDDVFKIAF 816
>LON_CHLPN (Q9Z9F4) ATP-dependent protease La (EC 3.4.21.53)| Length = 819 Score = 39.3 bits (90), Expect = 0.004 Identities = 15/32 (46%), Positives = 24/32 (75%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIYKLAF 318 N+RD++EL +K GL +HFV Y+++ K+AF Sbjct: 784 NRRDYEELPAYLKTGLKIHFVSHYDDVLKVAF 815
>LONM_CAEEL (O44952) Lon protease homolog, mitochondrial precursor (EC 3.4.21.-)| Length = 971 Score = 38.1 bits (87), Expect = 0.008 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIYKLAFQ 315 N+RDFD+L +K LD+ FV Y+E+Y+ FQ Sbjct: 939 NRRDFDDLPEFMKSELDIRFVSHYDELYEHLFQ 971
>LON_ECOLI (P0A9M0) ATP-dependent protease La (EC 3.4.21.53)| Length = 784 Score = 36.2 bits (82), Expect = 0.031 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIYKLAFQNE 309 NKRD +E+ NV LD+H V E+ LA QNE Sbjct: 740 NKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNE 774
>LON_ECOL6 (P0A9M1) ATP-dependent protease La (EC 3.4.21.53)| Length = 784 Score = 36.2 bits (82), Expect = 0.031 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIYKLAFQNE 309 NKRD +E+ NV LD+H V E+ LA QNE Sbjct: 740 NKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNE 774
>LON_ERWAM (P46067) ATP-dependent protease La (EC 3.4.21.53)| Length = 784 Score = 34.3 bits (77), Expect = 0.12 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIYKLAFQN 312 NKRD +E+ NV LD+H V E+ LA QN Sbjct: 740 NKRDLEEIPENVIADLDIHPVKRIEEVLALALQN 773
>LONM_YEAST (P36775) Lon protease homolog, mitochondrial precursor (EC 3.4.21.-)| Length = 1133 Score = 34.3 bits (77), Expect = 0.12 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIYKLAFQN 312 N D++EL NVKEGL+ D YN+I++ F++ Sbjct: 1076 NLNDWEELPDNVKEGLEPLAADWYNDIFQKLFKD 1109
>LON_TREPA (O83536) ATP-dependent protease La (EC 3.4.21.53)| Length = 881 Score = 33.9 bits (76), Expect = 0.15 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIYKLAF 318 N RD DE+ +VK+G+ H V++ E+ LAF Sbjct: 828 NVRDLDEIPEHVKKGMVFHLVESMEEVLSLAF 859
>LON_BUCAP (Q8K988) ATP-dependent protease La (EC 3.4.21.53)| Length = 777 Score = 32.7 bits (73), Expect = 0.34 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIYKLAFQN 312 NKR+ +E+ N+ EGL ++ V E+ K+A +N Sbjct: 740 NKRNLEEIPKNIIEGLTIYPVKNIEEVLKIALEN 773
>LON_BUCAI (P57549) ATP-dependent protease La (EC 3.4.21.53)| Length = 777 Score = 32.3 bits (72), Expect = 0.44 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIYKLAFQ 315 NKR+ +E+ N+ EGL++H + E+ KL+ + Sbjct: 740 NKRNLEEIPKNIIEGLNIHPIKKIEEVLKLSLE 772
>LON_AZOBR (P77810) ATP-dependent protease La (EC 3.4.21.53)| Length = 810 Score = 30.8 bits (68), Expect = 1.3 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIYKLAFQNETE 303 N++D E+ NVK GL++ V T +++ K A E E Sbjct: 746 NEKDLAEIPDNVKRGLEIIPVSTVDDVLKHALVREVE 782
>LON2_BORBU (O51558) ATP-dependent protease La homolog (EC 3.4.21.-)| Length = 813 Score = 30.8 bits (68), Expect = 1.3 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -1 Query: 413 NKRDFDELAPNVKEGLDVHFVDTYNEIY 330 NK+D+ +L VK+ +DV FV + E++ Sbjct: 780 NKKDYSKLPEEVKDNIDVKFVSSLEEVF 807
>LIRA4_HUMAN (P59901) Leukocyte immunoglobulin-like receptor subfamily A member| 4 precursor (Immunoglobulin-like transcript 7) (ILT-7) (CD85g antigen) Length = 499 Score = 30.0 bits (66), Expect = 2.2 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +2 Query: 254 KTLRNLNTLFELLASLFLSHSGKLTCIFHCMCQQSERQDPLSRLEQAHQNP 406 KTL + N + + S+ H+G+ C + SE DPL + A+ P Sbjct: 73 KTLESENKVKLSIPSMMWEHAGRYHCYYQSPAGWSEPSDPLELVVTAYSRP 123
>YHCE_BACSU (P54589) Hypothetical protein yhcE| Length = 253 Score = 28.5 bits (62), Expect = 6.4 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 18 IIKRTKQNLYIFGFVTNL*FFLFHIAP 98 I RTK+ L IFGF + FFL ++P Sbjct: 36 IASRTKEPLVIFGFFVAVAFFLLFLSP 62
>Y066_NPVAC (P41467) Hypothetical 94.0 kDa protein in POL-LEF3 intergenic| region Length = 808 Score = 28.1 bits (61), Expect = 8.3 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 4/65 (6%) Frame = +2 Query: 224 KLRSVFSLAPKTLRN----LNTLFELLASLFLSHSGKLTCIFHCMCQQSERQDPLSRLEQ 391 K++ + S+A + +++ LNT + L SLF+ ++ K IF +R + L+R Sbjct: 741 KIKEMESIADQAVKSEMSKLNTQLDELNSLFVKYNRKAQDIFEWKTSMLKRYETLARTTA 800 Query: 392 AHQNP 406 A P Sbjct: 801 ASVQP 805
>AMPA_MYCPA (Q73YK2) Probable cytosol aminopeptidase (EC 3.4.11.1) (Leucine| aminopeptidase) (LAP) (Leucyl aminopeptidase) Length = 515 Score = 28.1 bits (61), Expect = 8.3 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 209 EWPSCKLRSVFSLAPKTLRNLNTLFELLASL 301 EWP+ +R +A ++L N T+F LA+L Sbjct: 100 EWPADTVRRAAGVAARSLSNTETVFTTLAAL 130 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,213,383 Number of Sequences: 219361 Number of extensions: 891714 Number of successful extensions: 2357 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 2325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2357 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
