Clone Name | rbastl46f08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-as... | 28 | 5.6 | 2 | DCUA_HELPY (O25425) Anaerobic C4-dicarboxylate transporter dcuA | 28 | 7.3 | 3 | DCUA_HELPJ (Q9ZLC0) Anaerobic C4-dicarboxylate transporter dcuA | 28 | 7.3 | 4 | ISPD_ECO57 (Q8X7Y4) 2-C-methyl-D-erythritol 4-phosphate cytidyly... | 27 | 9.5 |
---|
>KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-associated| protein 10.7) (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) Length = 370 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = -3 Query: 329 NAKPRVC----CQRGFSVVGAIAPPMCIHPVTCFVVCADDFG 216 + KP C CQ+ V P+C PV C C+DD G Sbjct: 213 SCKPACCTSSPCQQACCV------PVCCKPVCCVPTCSDDSG 248
>DCUA_HELPY (O25425) Anaerobic C4-dicarboxylate transporter dcuA| Length = 443 Score = 27.7 bits (60), Expect = 7.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -1 Query: 106 SMLLYLMSPLGCTLLPRVKTESGCSAQKTQVLFLL 2 SMLLY + L+P V T G SA T+ L+++ Sbjct: 344 SMLLYSQAATSKALIPSVITALGISANHTEHLYII 378
>DCUA_HELPJ (Q9ZLC0) Anaerobic C4-dicarboxylate transporter dcuA| Length = 443 Score = 27.7 bits (60), Expect = 7.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -1 Query: 106 SMLLYLMSPLGCTLLPRVKTESGCSAQKTQVLFLL 2 SMLLY + L+P V T G SA T+ L+++ Sbjct: 344 SMLLYSQAATSKALIPSVITALGISANHTEHLYII 378
>ISPD_ECO57 (Q8X7Y4) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase| (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT) Length = 235 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 80 GRHQVQQHTIWTLLLREKVKATNIAASPG 166 G + +H+++ LL +VK IA SPG Sbjct: 32 GNQTILEHSVYALLAHPRVKRVVIAISPG 60 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,508,553 Number of Sequences: 219361 Number of extensions: 1036512 Number of successful extensions: 2670 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2606 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2668 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)