Clone Name | rbastl46f05 |
---|---|
Clone Library Name | barley_pub |
>MLL3_HUMAN (Q8NEZ4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) (Homologous to ALR protein) Length = 4911 Score = 39.3 bits (90), Expect = 0.004 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 429 CEDPPWDSIPDRAYCCRWCSWCKVCSEDS 343 C DPP ++P + C+WC WC+ C S Sbjct: 1036 CLDPPLQTVPKGGWKCKWCVWCRHCGATS 1064
>MLL3_MOUSE (Q8BRH4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) Length = 4903 Score = 39.3 bits (90), Expect = 0.004 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 429 CEDPPWDSIPDRAYCCRWCSWCKVCSEDS 343 C DPP ++P + C+WC WC+ C S Sbjct: 1029 CLDPPLQTVPKGGWKCKWCVWCRHCGATS 1057
>MLL2_HUMAN (O14686) Myeloid/lymphoid or mixed-lineage leukemia protein 2| (ALL1-related protein) Length = 5262 Score = 31.2 bits (69), Expect = 1.1 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 429 CEDPPWDSIPDRAYCCRWCSWCKVCSEDS 343 C DPP ++P + C+WC C C S Sbjct: 1181 CLDPPLLTVPKGGWKCKWCVSCMQCGAAS 1209
>ZNHI2_HUMAN (Q9UHR6) Zinc finger HIT domain-containing protein 2 (Protein FON)| Length = 403 Score = 29.6 bits (65), Expect = 3.2 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -1 Query: 329 VPLFFEAMESLIK*-VTGNLRMDIPSKLFSYEHTAVLFHG 213 VP A+ SL + V+ +R +P+ LF+Y HT L+HG Sbjct: 192 VPTRIPAIVSLSRGPVSPLVRFQLPNVLFAYAHTLALYHG 231
>ZNHI2_MOUSE (Q9QY66) Zinc finger HIT domain-containing protein 2 (Protein FON)| Length = 399 Score = 29.3 bits (64), Expect = 4.2 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 275 LRMDIPSKLFSYEHTAVLFHG 213 +R +P+ LF+Y HT L+HG Sbjct: 206 VRFQLPNVLFAYAHTLALYHG 226
>PXDC2_XENLA (Q6DE92) Plexin domain-containing protein 2 precursor| Length = 513 Score = 28.9 bits (63), Expect = 5.5 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 19/51 (37%) Frame = -3 Query: 375 CSWCKV-------------------CSEDSKQGVCASIL*SYGVSYQVSDG 280 CSWC + C+E+SK VC +L + G+S+ + G Sbjct: 331 CSWCNIPQRCSSGFDRHRQDWVENGCTEESKDTVCDDLLQTTGISHHTTTG 381
>MUKB_MANSM (Q65TL9) Chromosome partition protein mukB (Structural maintenance| of chromosome-related protein) Length = 1499 Score = 28.1 bits (61), Expect = 9.4 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = +2 Query: 314 QRIEAQ-TPCLESSLHTLHQEHQRQQ*AL 397 Q+++AQ TP L + LH L Q +Q+QQ A+ Sbjct: 537 QKLQAQQTPQLRAKLHELEQRYQQQQSAV 565
>MPAA5_AMBEL (P02878) Pollen allergen Amb a 5 (Amb a V) (Allergen Ra5)| Length = 45 Score = 28.1 bits (61), Expect = 9.4 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 4/23 (17%) Frame = -3 Query: 396 RAYCC----RWCSWCKVCSEDSK 340 RAYCC R+C W VC E S+ Sbjct: 15 RAYCCSDPGRYCPWQVVCYESSE 37
>MPA5A_AMBPS (P43174) Pollen allergen Amb p 5a precursor (Amb p Va)| Length = 77 Score = 28.1 bits (61), Expect = 9.4 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 4/23 (17%) Frame = -3 Query: 396 RAYCC----RWCSWCKVCSEDSK 340 RAYCC R+C W VC E S+ Sbjct: 37 RAYCCSDPGRYCPWQVVCYESSE 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,071,410 Number of Sequences: 219361 Number of extensions: 1104323 Number of successful extensions: 3073 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2983 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3069 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)