| Clone Name | rbastl46f03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FBX15_MACFA (Q9GKV7) F-box only protein 15 | 28 | 6.0 | 2 | Y924_THET8 (Q56419) UPF0103 protein TTHA0924 | 28 | 6.0 | 3 | VP40_BHV1C (P54817) Capsid protein P40 [Contains: Assemblin (Pro... | 28 | 7.9 |
|---|
>FBX15_MACFA (Q9GKV7) F-box only protein 15| Length = 434 Score = 28.1 bits (61), Expect = 6.0 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = +1 Query: 1 ERKGKKPSIELIDGAMGRELVTGVVYGSTGPCPGKIRLSSL--PAPVRWERQQHPAGCRR 174 E+ GK+ +E +D ++ VT + YG PC + L PV + + P R Sbjct: 128 EKSGKEYIMEHVDLSVNDTSVTVIWYGKNWPCLASLSTLDLCGVTPVFMDWYKTPTKHRL 187 Query: 175 RW 180 RW Sbjct: 188 RW 189
>Y924_THET8 (Q56419) UPF0103 protein TTHA0924| Length = 326 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 80 PYTTPVTSSLPIAPSINSIDGFLPF 6 P+ TP +LP P++ ++D LPF Sbjct: 146 PFQTPFGPALPDLPALQALDALLPF 170
>VP40_BHV1C (P54817) Capsid protein P40 [Contains: Assemblin (Protease) (EC| 3.4.21.97); Capsid assembly protein] Length = 621 Score = 27.7 bits (60), Expect = 7.9 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 15/71 (21%) Frame = -3 Query: 191 RHLVQRRR----QPAGCCCRSQRTGAGNDDSRIFPG-----------HGPVDPYTTPVTS 57 R L +RRR P G R+G G+DD +PG H P P+ P + Sbjct: 435 RPLAKRRRYNWDHPRG------RSGGGDDDEAYYPGEGAPAELPPHHHSPPPPHPPPSHA 488 Query: 56 SLPIAPSINSI 24 +A +++S+ Sbjct: 489 LSKLASAVSSL 499 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,316,155 Number of Sequences: 219361 Number of extensions: 559963 Number of successful extensions: 1677 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1677 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)