| Clone Name | rbastl46d10 |
|---|---|
| Clone Library Name | barley_pub |
>XPC_MOUSE (P51612) DNA-repair protein complementing XP-C cells homolog| (Xeroderma pigmentosum group C-complementing protein homolog) (p125) Length = 930 Score = 32.3 bits (72), Expect = 0.50 Identities = 16/71 (22%), Positives = 28/71 (39%) Frame = +3 Query: 99 DDNGWWLKITRRLQRAKAMMEMTVSQTPRWW*HMIKPYTPLMKRKENMEHETGKKTKLQC 278 D +GW +T+R A WW ++PY L+ +E E + + Sbjct: 566 DSDGWVRDVTQRYDPAWMTATRKCRVDAEWWAETLRPYRSLLTEREKKEDQEFQAK---- 621 Query: 279 HCSSPSPVTVT 311 H P P +++ Sbjct: 622 HLDQPLPTSIS 632
>SMRC2_MOUSE (Q6PDG5) SWI/SNF-related matrix-associated actin-dependent regulator| of chromatin subfamily C member 2 (SWI/SNF complex 170 kDa subunit) (BRG1-associated factor 170) Length = 1213 Score = 30.4 bits (67), Expect = 1.9 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = -3 Query: 194 LPPSRGL*YSHLHHSFGPL*SPGNLQPPSIVISFTLVVYAEMCATNTTP 48 LPP L H HH P +PG + PP++ +S ++ + AT T P Sbjct: 1109 LPPPPNL---HGHHHHLPF-APGTIPPPNLPVSMANPLHPNLPATTTMP 1153
>SMRC2_HUMAN (Q8TAQ2) SWI/SNF-related matrix-associated actin-dependent regulator| of chromatin subfamily C member 2 (SWI/SNF complex 170 kDa subunit) (BRG1-associated factor 170) Length = 1214 Score = 29.3 bits (64), Expect = 4.2 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -3 Query: 164 HLHHSFGPL*SPGNLQPPSIVISFTLVVYAEMCATNTTP 48 H HH P +PG L PP++ +S ++ + AT T P Sbjct: 1117 HGHHHHLPF-APGTLPPPNLPVSMANPLHPNLPATTTMP 1154
>B2MG_ICTPU (O42197) Beta-2-microglobulin precursor| Length = 116 Score = 29.3 bits (64), Expect = 4.2 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +3 Query: 249 ETGKKTKLQCHCSSPSPVTVTVDLPKNCRMLAPISST 359 E GK+ L CH S P +T+DL KN ++ T Sbjct: 35 EFGKENTLICHVSDFHPPDITIDLLKNGEVIPNAEQT 71
>B2MG_BARIN (P55076) Beta-2-microglobulin precursor| Length = 116 Score = 28.5 bits (62), Expect = 7.2 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +3 Query: 204 KPYTPLMKRKENMEHETGKKTKLQCHCSSPSPVTVTVDLPKNCRMLAPISST 359 K +P ++ + E GK+ L CH S P +T++L +N +L T Sbjct: 20 KTSSPKVQVYSHFPGEYGKENTLICHVSGFHPPDITIELLRNGEILPNTQQT 71
>STAG2_MOUSE (O35638) Cohesin subunit SA-2 (Stromal antigen 2) (SCC3 homolog 2)| Length = 1231 Score = 28.1 bits (61), Expect = 9.4 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -1 Query: 199 ICYHHLGVCDTVISIIALA-LCNLLVIFSHHPLS 101 IC H+L +T + A LC++L+IFSH +S Sbjct: 771 ICQHYLTNVNTTVKEQAFTILCDILMIFSHQIMS 804
>STAG2_HUMAN (Q8N3U4) Cohesin subunit SA-2 (Stromal antigen 2) (SCC3 homolog 2)| Length = 1231 Score = 28.1 bits (61), Expect = 9.4 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -1 Query: 199 ICYHHLGVCDTVISIIALA-LCNLLVIFSHHPLS 101 IC H+L +T + A LC++L+IFSH +S Sbjct: 771 ICQHYLTNVNTTVKEQAFTILCDILMIFSHQIMS 804
>PHAR1_XENLA (Q6GLU8) Phosphatase and actin regulator 1| Length = 586 Score = 28.1 bits (61), Expect = 9.4 Identities = 13/61 (21%), Positives = 27/61 (44%), Gaps = 9/61 (14%) Frame = +3 Query: 207 PYTPLMKRKENMEHETGKKTKLQCH---------CSSPSPVTVTVDLPKNCRMLAPISST 359 PY P +K + H T ++L H + S +++ +P CR++ ++ T Sbjct: 275 PYGPYSNQKSSQHHHTVLPSQLAAHQLQYGSQHFSTGSSSISIHPSIPPGCRVIEELNKT 334 Query: 360 V 362 + Sbjct: 335 L 335 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,486,568 Number of Sequences: 219361 Number of extensions: 1270648 Number of successful extensions: 2453 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2453 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)