Clone Name | rbastl46c09 |
---|---|
Clone Library Name | barley_pub |
>UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA replication| protein BSLF1) Length = 874 Score = 32.7 bits (73), Expect = 0.38 Identities = 15/59 (25%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +2 Query: 77 FCCHDNIDEILMLTSIHPYSQHIQKLTTPPTSCIGTEASYSDQMA--PTRYVQNSRADE 247 F CH ++T+ P+S H+ ++ + PT+C + + ++ P Y QNS +++ Sbjct: 424 FLCHFADRHYFVMTAADPFSSHLAEVVSTPTNCRLPDTCLTRALSYTPVYYSQNSLSEQ 482
>YKKA_CAEEL (Q95QY7) Putative zinc finger protein C02F5.12| Length = 380 Score = 31.2 bits (69), Expect = 1.1 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 122 IHPYSQHIQKLTTPPTSC 175 IHP +Q IQK TPPTSC Sbjct: 43 IHPPAQKIQKPATPPTSC 60
>CUL5_CAEEL (Q23639) Cullin-5| Length = 741 Score = 29.6 bits (65), Expect = 3.2 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 303 VISWADDRPL-VENDLHRCLKQIIRRASSSFRTVEAYGRGTLG 428 + SW DD PL + + L RC+ + A+ R+++ G +G Sbjct: 38 ITSWVDDGPLKIRDILTRCINDYVHEANKRIRSLQTDGSLLIG 80
>GPA17_CAEEL (Q18434) Guanine nucleotide-binding protein alpha-17 subunit| (Odorant response abnormal protein 3) Length = 356 Score = 28.1 bits (61), Expect = 9.4 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 44 IGGTHSHAGTRFCCHDNIDEILMLTSIHPYSQ 139 +GG S C DN++ I+ +T+I Y Q Sbjct: 203 VGGQRSERRKWIHCFDNVESIIFITAISEYDQ 234
>GPA17_CAEBR (Q86FX7) Guanine nucleotide-binding protein alpha-17 subunit| (Odorant response abnormal protein 3) Length = 356 Score = 28.1 bits (61), Expect = 9.4 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 44 IGGTHSHAGTRFCCHDNIDEILMLTSIHPYSQ 139 +GG S C DN++ I+ +T+I Y Q Sbjct: 203 VGGQRSERRKWIHCFDNVESIIFITAISEYDQ 234
>EGFL7_HUMAN (Q9UHF1) EGF-like domain-containing protein 7 precursor (Multiple| EGF-like domain protein 7) (Multiple epidermal growth factor-like domain protein 7) (Vascular endothelial statin) (VE-statin) (NOTCH4-like protein) (ZNEU1) Length = 273 Score = 28.1 bits (61), Expect = 9.4 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -2 Query: 276 CPASFPVETCSSAREFCTYRVGAI*SL*DASVPMQLVGGVVSF-CMCWE 133 CPA + +TC S + C+ R G P + V S+ C CWE Sbjct: 125 CPAGWRGDTCQSDVDECSARRG--------GCPQRCVNTAGSYWCQCWE 165 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,516,758 Number of Sequences: 219361 Number of extensions: 1208731 Number of successful extensions: 2620 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2619 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)