| Clone Name | rbastl46b07 |
|---|---|
| Clone Library Name | barley_pub |
>HAX1_MOUSE (O35387) HS1-associating protein X-1 (HAX-1) (HS1-binding protein)| Length = 280 Score = 31.2 bits (69), Expect = 0.76 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 121 GSSGPFDDLLDTWDVVFLSLLPHFGASEPLDYDSMV 14 GS GPF L DTW V PH A E D DS V Sbjct: 162 GSQGPFHRLDDTWPV-----SPHSRAKEDKDLDSQV 192
>CAND_DROME (P27398) Calpain D (EC 3.4.22.-) (Calcium-activated neutral| proteinase D) (CANP D) (Small optic lobes protein) Length = 1594 Score = 28.9 bits (63), Expect = 3.8 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 43 RHQSVAASLGTQHPRCPTGHQRGHYYHHYI 132 R Q +A SLG + H H++HHY+ Sbjct: 176 RGQDLAGSLGNRGELLAADHSHPHHHHHYL 205
>NPBW2_BOVIN (Q8MJV2) Neuropeptides B/W receptor type 2 (G-protein coupled| receptor 8) Length = 336 Score = 28.1 bits (61), Expect = 6.4 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = -2 Query: 177 HLRVPTFGDALI*YQYVVMVVVAPLMTCWTPGMLCS*ACCHTLVPQNLWIMIV 19 H G A +V+ V+A + CWTP L S T +PQ ++IV Sbjct: 245 HSGAKALGKAKRKVSLLVLAVLAVGLLCWTPFHLASIVALTTDLPQTPLVIIV 297
>ACM4_XENLA (P30544) Muscarinic acetylcholine receptor M4| Length = 484 Score = 27.7 bits (60), Expect = 8.4 Identities = 10/41 (24%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -2 Query: 126 VMVVVAPLMTCWTPG--MLCS*ACCHTLVPQNLWIMIVWCC 10 + ++ + WTP M+ C T +P+ +W + W C Sbjct: 407 IFAILLAFIITWTPYNVMVLINTFCQTCIPETIWYIGYWLC 447
>NPBW2_HUMAN (P48146) Neuropeptides B/W receptor type 2 (G-protein coupled| receptor 8) Length = 333 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 129 VVMVVVAPLMTCWTPGMLCS*ACCHTLVPQ 40 +V+VV+A + CWTP L S T +PQ Sbjct: 261 LVLVVLAVCLLCWTPFHLASVVALTTDLPQ 290 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,743,240 Number of Sequences: 219361 Number of extensions: 549426 Number of successful extensions: 1519 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1513 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)