| Clone Name | rbastl46b06 |
|---|---|
| Clone Library Name | barley_pub |
>LOX1_HORVU (P29114) Lipoxygenase 1 (EC 1.13.11.12)| Length = 862 Score = 33.5 bits (75), Expect = 0.13 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 372 HTGQAEGLTARGIPNSISI 316 H G A GLTA+GIPNSISI Sbjct: 844 HKGAAAGLTAKGIPNSISI 862
>LOX1_ORYSA (Q76I22) Lipoxygenase 1 (EC 1.13.11.12) (9-lipoxygenase) (r9-LOX1)| Length = 863 Score = 33.5 bits (75), Expect = 0.13 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -1 Query: 366 GQAEGLTARGIPNSISI 316 G AEG+TARGIPNSISI Sbjct: 847 GAAEGITARGIPNSISI 863
>LOX3_ORYSA (Q7G794) Putative lipoxygenase 3 (EC 1.13.11.12)| Length = 866 Score = 32.0 bits (71), Expect = 0.38 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 369 TGQAEGLTARGIPNSISI 316 TG A G+TA+GIPNSISI Sbjct: 849 TGAAAGITAKGIPNSISI 866
>LOX2_ORYSA (P29250) Lipoxygenase 2 (EC 1.13.11.12) (Lipoxygenase L-2)| Length = 870 Score = 30.8 bits (68), Expect = 0.84 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 366 GQAEGLTARGIPNSISI 316 G A GL+ARGIPNSISI Sbjct: 854 GDAAGLSARGIPNSISI 870
>LOX2_PEA (P14856) Seed lipoxygenase-2 (EC 1.13.11.12)| Length = 864 Score = 30.8 bits (68), Expect = 0.84 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -1 Query: 372 HTGQAEGLTARGIPNSISI 316 H EGLT RGIPNSISI Sbjct: 846 HPSSKEGLTFRGIPNSISI 864
>LOX2_SOYBN (P09439) Seed lipoxygenase-2 (EC 1.13.11.12) (L-2)| Length = 865 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 360 AEGLTARGIPNSISI 316 +EGLT RGIPNSISI Sbjct: 851 SEGLTCRGIPNSISI 865
>LOXX_SOYBN (P24095) Seed lipoxygenase (EC 1.13.11.12)| Length = 864 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 372 HTGQAEGLTARGIPNSISI 316 H EGLT +GIPNSISI Sbjct: 846 HRSSEEGLTFKGIPNSISI 864
>LOXA_PHAVU (P27480) Lipoxygenase 1 (EC 1.13.11.12)| Length = 862 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 369 TGQAEGLTARGIPNSISI 316 T + EGLT RGIPNSISI Sbjct: 845 TCEDEGLTFRGIPNSISI 862
>LOX1_LENCU (P38414) Lipoxygenase (EC 1.13.11.12)| Length = 866 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 357 EGLTARGIPNSISI 316 EGLT RGIPNSISI Sbjct: 853 EGLTCRGIPNSISI 866
>LOX3_PEA (P09918) Seed lipoxygenase-3 (EC 1.13.11.12)| Length = 861 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 357 EGLTARGIPNSISI 316 EGLT RGIPNSISI Sbjct: 848 EGLTFRGIPNSISI 861
>LOX4_SOYBN (P38417) Lipoxygenase-4 (EC 1.13.11.12) (L-4) (VSP94)| Length = 853 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 357 EGLTARGIPNSISI 316 EGLT RGIPNSISI Sbjct: 840 EGLTFRGIPNSISI 853
>LOX1_SOYBN (P08170) Seed lipoxygenase-1 (EC 1.13.11.12) (L-1)| Length = 839 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 357 EGLTARGIPNSISI 316 EGLT RGIPNSISI Sbjct: 826 EGLTFRGIPNSISI 839
>LOX3_SOYBN (P09186) Seed lipoxygenase-3 (EC 1.13.11.12) (L-3)| Length = 857 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 357 EGLTARGIPNSISI 316 EGLT RGIPNSISI Sbjct: 844 EGLTFRGIPNSISI 857
>NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (Motch B) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2470 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = -1 Query: 243 CVCV-------CDRELCRCMNN*GNKGACTTGLIGMRKLSSAGYRSMHRRVQK 106 C+C C ++ C++N G CT GL G + L AG+ ++ V K Sbjct: 704 CICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDK 756
>NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (hN2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = -1 Query: 243 CVCV-------CDRELCRCMNN*GNKGACTTGLIGMRKLSSAGYRSMHRRVQK 106 C+C C ++ C++N G CT GL G + L AG+ ++ V K Sbjct: 706 CICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDK 758
>PLCG1_RAT (P10686) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase| gamma 1 (EC 3.1.4.11) (Phosphoinositide phospholipase C) (PLC-gamma-1) (Phospholipase C-gamma-1) (PLC-II) (PLC-148) Length = 1290 Score = 27.7 bits (60), Expect = 7.1 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +3 Query: 54 PEGTSHHRLHYWAKQGIFSAHDDALTGSQLS*ASACRSDPSCTHPYC 194 PE ++ HYW I S+H+ LTG Q S S+ + C C Sbjct: 319 PETMNNPLSHYW----ISSSHNTYLTGDQFSSESSLEAYARCLRMGC 361
>LOX4_ORYSA (Q53RB0) Probable lipoxygenase 4 (EC 1.13.11.12)| Length = 877 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -1 Query: 363 QAEGLTARGIPNSISI 316 + +GLTA GIPNSISI Sbjct: 862 KGQGLTAMGIPNSISI 877
>CB024_HUMAN (Q9BV87) Protein C2orf24| Length = 410 Score = 27.7 bits (60), Expect = 7.1 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 5/65 (7%) Frame = -1 Query: 327 SISI*SEHVRRRDLMLLCYPCLLTPELACVCVCDRELC-----RCMNN*GNKGACTTGLI 163 ++++ S V + L L C P P+L C E C +C+ + N +C G + Sbjct: 244 ALAVASVAVIHQSLGLSCTPTPGPPDLGLTSRCLLEPCIPSVPQCLPSPANVSSCLEGSM 303 Query: 162 GMRKL 148 G+R L Sbjct: 304 GLRSL 308
>LOXB_LYCES (P38416) Lipoxygenase B (EC 1.13.11.12)| Length = 859 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -1 Query: 357 EGLTARGIPNSISI 316 EGLT +GIPNS+SI Sbjct: 846 EGLTGKGIPNSVSI 859
>KLDC4_HUMAN (Q8TBB5) Kelch domain-containing protein 4| Length = 520 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 39 KNNGGPEGTSHHRLHYWAKQ 98 K+ GGP G S HR+ W +Q Sbjct: 169 KSTGGPSGRSGHRMVAWKRQ 188
>APEA_THENE (O86957) Probable M18-family aminopeptidase 1 (EC 3.4.11.-)| Length = 452 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 39 KNNGGPEGTSHHRLHYWAKQGIFS 110 K GGPE + H + YW K + S Sbjct: 303 KIQGGPEIQNSHSMRYWKKSAVIS 326
>ADA33_MOUSE (Q923W9) ADAM 33 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 33) Length = 797 Score = 27.3 bits (59), Expect = 9.3 Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 7/57 (12%) Frame = -1 Query: 153 KLSSAGYRSMHRRVQKKSLVLPNNEVDGVMFPPALRCFSPSWQT-------SGIVVI 4 KL + GY H R +VL N D + +R F SW SG++V+ Sbjct: 87 KLLAPGYTETHYRPDGHPVVLSPNHTDHCQYHGRVRGFRESWVVLSTCSGMSGLIVL 143
>ARNT_RAT (P41739) Aryl hydrocarbon receptor nuclear translocator (ARNT| protein) (Dioxin receptor, nuclear translocator) (Hypoxia-inducible factor 1 beta) (HIF-1 beta) Length = 800 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -3 Query: 349 HRQGHPEQHIHLI*ARPSSRPHAF--VLSLL 263 HR EQH+ A+PSS+P F +LS+L Sbjct: 747 HRSSSNEQHVQPTSAQPSSQPEVFQEMLSML 777
>KPTA_BURS3 (Q395F2) Probable RNA 2'-phosphotransferase (EC 2.7.-.-)| Length = 194 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 148 ELPHADQTRRARTLIALIIHAPAQLSV 228 ELP D TR +RTL L+ HAP + + Sbjct: 7 ELPAPDATRISRTLSYLLRHAPQTIGL 33 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,698,131 Number of Sequences: 219361 Number of extensions: 1176690 Number of successful extensions: 2946 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 2858 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2944 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)