Clone Name | rbastl46b04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SFR12_RAT (Q9JKL7) Splicing factor, arginine/serine-rich 12 (Ser... | 28 | 7.6 |
---|
>SFR12_RAT (Q9JKL7) Splicing factor, arginine/serine-rich 12| (Serine-arginine-rich splicing regulatory protein 86) (SRrp86) (SR-related protein of 86 kDa) Length = 494 Score = 27.7 bits (60), Expect = 7.6 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 208 EGARTKDARQQGAKEKEKRMTPRSVSSQDDCRSS 309 E R+K+A ++ KEK+ R PRS +S RS+ Sbjct: 329 EKDRSKEADEKRKKEKKSRTPPRSYNSSRRSRSA 362 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,671,177 Number of Sequences: 219361 Number of extensions: 494947 Number of successful extensions: 1018 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1010 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1018 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)