Clone Name | rbastl46a08 |
---|---|
Clone Library Name | barley_pub |
>NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (hN2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 28.1 bits (61), Expect = 5.6 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = -3 Query: 281 CVCV-------CDKKLCRCMNN*GNKGACTTGLIGMRKLSSAGYRSMHRRVQK 144 C+C C ++ C++N G CT GL G + L AG+ ++ V K Sbjct: 706 CICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDK 758
>PLCG1_RAT (P10686) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase| gamma 1 (EC 3.1.4.11) (Phosphoinositide phospholipase C) (PLC-gamma-1) (Phospholipase C-gamma-1) (PLC-II) (PLC-148) Length = 1290 Score = 28.1 bits (61), Expect = 5.6 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +2 Query: 92 PEGTSHHRLHYWAKQGIFSAHDDALTGSQLS*ASACRSNPSCTHPYC 232 PE ++ HYW I S+H+ LTG Q S S+ + C C Sbjct: 319 PETMNNPLSHYW----ISSSHNTYLTGDQFSSESSLEAYARCLRMGC 361
>NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (Motch B) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2470 Score = 28.1 bits (61), Expect = 5.6 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = -3 Query: 281 CVCV-------CDKKLCRCMNN*GNKGACTTGLIGMRKLSSAGYRSMHRRVQK 144 C+C C ++ C++N G CT GL G + L AG+ ++ V K Sbjct: 704 CICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDK 756
>NADD_STRR6 (P65505) Probable nicotinate-nucleotide adenylyltransferase (EC| 2.7.7.18) (Deamido-NAD(+) pyrophosphorylase) (Deamido-NAD(+) diphosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) Length = 209 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +1 Query: 13 TEELATPKLKITTMPEVCQEKKKQ-RRAGGNITP 111 T EL TP K+ PE+ ++K+KQ GGN P Sbjct: 2 TIELLTPFTKVELEPEIKEKKRKQVGILGGNFNP 35
>NADD_STRPN (P65504) Probable nicotinate-nucleotide adenylyltransferase (EC| 2.7.7.18) (Deamido-NAD(+) pyrophosphorylase) (Deamido-NAD(+) diphosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) Length = 209 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +1 Query: 13 TEELATPKLKITTMPEVCQEKKKQ-RRAGGNITP 111 T EL TP K+ PE+ ++K+KQ GGN P Sbjct: 2 TIELLTPFTKVELEPEIKEKKRKQVGILGGNFNP 35
>FTSW_SYNY3 (P74180) Probable cell division protein ftsW| Length = 393 Score = 27.7 bits (60), Expect = 7.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 89 LRCFFFSWQTSGIVVIFSLGVA 24 +R FF+W G+VV+FS A Sbjct: 29 MRTLFFAWMAMGVVVLFSASYA 50
>XMAS1_DROME (Q9U3V8) Protein xmas-1| Length = 736 Score = 27.3 bits (59), Expect = 9.6 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 1 ETEETEELATPKLKITTMPEVCQEKKKQRRAGGN 102 E EE E A P+L+IT +E + QRR G+ Sbjct: 167 EDEEVERRAVPQLRITKEQSEEEEHQLQRRKDGS 200
>APEA_THENE (O86957) Probable M18-family aminopeptidase 1 (EC 3.4.11.-)| Length = 452 Score = 27.3 bits (59), Expect = 9.6 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 77 KNNGGPEGTSHHRLHYWAKQGIFS 148 K GGPE + H + YW K + S Sbjct: 303 KIQGGPEIQNSHSMRYWKKSAVIS 326
>ACV1C_HUMAN (Q8NER5) Activin receptor type 1C precursor (EC 2.7.11.30)| (ACTR-IC) (Activin receptor-like kinase 7) (ALK-7) Length = 493 Score = 27.3 bits (59), Expect = 9.6 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 335 RRDLMLLCYPCLLTPELACVC-VCDKKLCRCMNN*GNKGAC 216 R+ L+LL L+P L CVC +CD C +GAC Sbjct: 10 RQALLLLAAAAELSPGLKCVCLLCDSSNFTCQ----TEGAC 46
>KLDC4_HUMAN (Q8TBB5) Kelch domain-containing protein 4| Length = 520 Score = 27.3 bits (59), Expect = 9.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 77 KNNGGPEGTSHHRLHYWAKQ 136 K+ GGP G S HR+ W +Q Sbjct: 169 KSTGGPSGRSGHRMVAWKRQ 188 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,531,384 Number of Sequences: 219361 Number of extensions: 1037144 Number of successful extensions: 2515 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2513 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)