Clone Name | rbastl46a07 |
---|---|
Clone Library Name | barley_pub |
>MTAL1_KLULA (Q08398) Mating-type protein ALPHA1 (Transcription activator| Alpha1p) (MATalpha1 protein) Length = 261 Score = 30.4 bits (67), Expect = 1.8 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 258 LQTIINTHVTSQKYTAQNWLLLTSQFLCGETPK 356 L TII+ H T K T +NW L+ ++ C + K Sbjct: 129 LSTIISKHWTVDKQTRKNWELIAQEYNCDASGK 161
>RFC1_DROME (P35600) Activator 1 140 kDa subunit (Replication factor C large| subunit) (Germline transcription factor 1) Length = 986 Score = 29.3 bits (64), Expect = 4.0 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 236 LVSRRRRPNSCWSLGMNKAFFSS 168 LV +R R NS WSL +AFFSS Sbjct: 747 LVEKRIRANSAWSLLPTQAFFSS 769
>CCNB3_MOUSE (Q810T2) G2/mitotic-specific cyclin-B3| Length = 1396 Score = 29.3 bits (64), Expect = 4.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 Query: 114 FLHNL*QCTVVLEYSVGYNISCQHCRSRKLN 22 ++ NL C LEY GY ++ H RKLN Sbjct: 1319 YMRNLSNCVPTLEYFTGYKMAELHILVRKLN 1349
>TILS_BUCBP (Q89AX3) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 438 Score = 28.9 bits (63), Expect = 5.3 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 2 ISQNNLRFSFRLLQC*HDIL*PTEYSKTTVHCYKLCKN 115 + +NNL F+FR + H + +E K + HC K+C N Sbjct: 34 LKKNNLNFTFRAIHINHQLHPDSE--KWSDHCKKICIN 69
>OPT9_ARATH (Q9FJD2) Probable oligopeptide transporter 9 (AtOPT9)| Length = 741 Score = 28.9 bits (63), Expect = 5.3 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = -2 Query: 215 PNSCWSLGMNKAFFSSSVKWDVFVSPPMLLFLFSSYTICNNVLWFWSILSVTIYRV 48 P+S W+ M++ FF +SV W + V P + Y N WF+ + ++ + V Sbjct: 568 PDSEWTCPMDRVFFDASVIWGL-VGPRRMFGNLGEYAAIN---WFFLVGAIAPFFV 619
>OPT2_ARATH (O04514) Probable oligopeptide transporter 2 (AtOPT2)| Length = 722 Score = 28.9 bits (63), Expect = 5.3 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -2 Query: 215 PNSCWSLGMNKAFFSSSVKWDVFVSPPMLLFLFSSYTICNNVLWFW 78 PNS W+ ++ FF +SV W + V P + +Y N WF+ Sbjct: 524 PNSPWTCPSDRVFFDASVIWGL-VGPKRIFGRLGNYPALN---WFF 565
>LGT_MANSM (Q65VJ7) Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)| Length = 268 Score = 28.9 bits (63), Expect = 5.3 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 15/55 (27%) Frame = -2 Query: 242 WILVSRRRRPNSCWSL---------GMNKAFFSSSV------KWDVFVSPPMLLF 123 W+ V R RP+S W++ G F + +WD+FV P LF Sbjct: 39 WLAVKRANRPDSGWTVEQVDNLLFNGFAGVFLGGRIGYVLFYQWDLFVQEPSYLF 93
>DNAA_HELPJ (Q9ZJ96) Chromosomal replication initiator protein dnaA| Length = 457 Score = 28.1 bits (61), Expect = 9.0 Identities = 17/40 (42%), Positives = 19/40 (47%) Frame = -2 Query: 284 YMSVDYCLEERKKPWILVSRRRRPNSCWSLGMNKAFFSSS 165 Y SV LEE K P+IL R N L K F+SS Sbjct: 417 YSSVKKMLEEEKSPFILSLREEIKNRLNELNDKKTAFNSS 456
>BIME_EMENI (P24686) Negative regulator of mitosis| Length = 2073 Score = 28.1 bits (61), Expect = 9.0 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 162 DRRRKKSLVHSQAPARVRPPSPRDQNPWL 248 D R K+ ++ S PAR RP S PWL Sbjct: 1946 DAREKELVLPSSFPARPRPSSTPHDAPWL 1974
>Y103_MYCPN (P75566) Hypothetical protein MPN103 (C09_orf172)| Length = 172 Score = 28.1 bits (61), Expect = 9.0 Identities = 19/61 (31%), Positives = 29/61 (47%) Frame = -2 Query: 236 LVSRRRRPNSCWSLGMNKAFFSSSVKWDVFVSPPMLLFLFSSYTICNNVLWFWSILSVTI 57 ++ R S WS G ++ F++ + W F S L FLF+ + WFW IL + Sbjct: 53 IIGNRWLFRSFWSTGTLRSIFNTRILW-FFRS---LRFLFNYFN-----WWFWFILDLLK 103 Query: 56 Y 54 Y Sbjct: 104 Y 104 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,235,784 Number of Sequences: 219361 Number of extensions: 1204452 Number of successful extensions: 3489 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3489 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)