| Clone Name | rbastl46a04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | INO80_NEUCR (Q872I5) Putative DNA helicase ino-80 (EC 3.6.1.-) | 30 | 1.8 | 2 | PKHB1_MOUSE (Q9QYE9) Pleckstrin homology domain-containing famil... | 28 | 4.0 | 3 | RIMB1_HUMAN (O95153) Peripheral-type benzodiazepine receptor-ass... | 28 | 6.8 | 4 | PKHB1_HUMAN (Q9UF11) Pleckstrin homology domain-containing famil... | 28 | 6.8 | 5 | TRI_THEAC (P96086) Tricorn protease (EC 3.4.21.-) | 28 | 6.8 | 6 | PAGO_SALTY (O30646) Protein pagO | 27 | 8.9 |
|---|
>INO80_NEUCR (Q872I5) Putative DNA helicase ino-80 (EC 3.6.1.-)| Length = 2001 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = +2 Query: 209 APTSEGSLTESLSWSFVLRPCSISAPT 289 AP S GSLT S+S LRP S+++PT Sbjct: 399 APASVGSLTGSISPRLSLRPPSMASPT 425
>PKHB1_MOUSE (Q9QYE9) Pleckstrin homology domain-containing family B member 1| (Pleckstrin homology domain retinal protein 1) (PH domain-containing protein in retina 1) (PHRET1) Length = 243 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = -2 Query: 388 GPVKLTPGAKHILVPSDSTHGDSMPVYSCLSFGSRSGNAAGS 263 GP PG H++V D + P+ + G+ +G A GS Sbjct: 194 GPPYAGPGVTHVIVREDPCYSSGAPLAMGMLAGAATGAALGS 235
>RIMB1_HUMAN (O95153) Peripheral-type benzodiazepine receptor-associated protein| 1 (PRAX-1) (Peripheral benzodiazepine receptor-interacting protein) (PBR-IP) (RIM-binding protein 1) (RIM-BP1) Length = 1857 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 376 LTPGAKHILVPSDSTHGDSMPVYSCLSFGSRSG 278 L G HI V + ++ G S P+ CL+ G+R+G Sbjct: 850 LWAGPLHISVQALTSRGSSDPLRCCLAVGARAG 882
>PKHB1_HUMAN (Q9UF11) Pleckstrin homology domain-containing family B member 1| (Pleckstrin homology domain retinal protein 1) (PH domain-containing protein in retina 1) (PHRET1) Length = 243 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = -2 Query: 388 GPVKLTPGAKHILVPSDSTHGDSMPVYSCLSFGSRSGNAAGS 263 GP PG H++V D + P+ + G+ +G A GS Sbjct: 194 GPPYAGPGVTHVIVREDPCYSAGAPLAMGMLAGAATGAALGS 235
>TRI_THEAC (P96086) Tricorn protease (EC 3.4.21.-)| Length = 1071 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = -2 Query: 397 KRSGPVKLTPGAKHILVPSDSTHGDSMPVYSCLSFGSRSGNAAGSQNKG 251 KRS P+ + PG +++P +S S+ +YS G + G+ KG Sbjct: 573 KRSSPINVDPGDYRMIIPLES----SILIYSVPVHGEFAAYYQGAPEKG 617
>PAGO_SALTY (O30646) Protein pagO| Length = 304 Score = 27.3 bits (59), Expect = 8.9 Identities = 23/62 (37%), Positives = 28/62 (45%), Gaps = 6/62 (9%) Frame = -2 Query: 172 SCTNSCHTFSCFICLLGSYFLS*TCIHGWCIPKACTLIFSVF-----L*I*MISGI-GRL 11 SCT S TF+ CLL LS T GW + FSV L + +G+ G L Sbjct: 174 SCTVSVITFNALPCLLAGLILSAT---GWFFERPQVSTFSVHSILATLYLGAFAGVFGIL 230 Query: 10 CY 5 CY Sbjct: 231 CY 232 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,474,644 Number of Sequences: 219361 Number of extensions: 969104 Number of successful extensions: 2094 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2061 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2094 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)