Clone Name | rbastl46a03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MRPD_BACSU (O05229) Na(+)/H(+) antiporter subunit D (Multiple re... | 30 | 4.7 | 2 | GATA_NEIMB (Q9JYZ9) Glutamyl-tRNA(Gln) amidotransferase subunit ... | 29 | 7.9 | 3 | GATA_NEIMA (Q9JTZ5) Glutamyl-tRNA(Gln) amidotransferase subunit ... | 29 | 7.9 |
---|
>MRPD_BACSU (O05229) Na(+)/H(+) antiporter subunit D (Multiple resistance and| pH homeostasis protein D) (Mrp complex subunit D) Length = 493 Score = 29.6 bits (65), Expect = 4.7 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = +3 Query: 189 NILFFLNAELCASNTILLTRHSFWENEEENPQTTFQHGKASVYP 320 ++L L++ L + + + H+FW E+E P+ + K +YP Sbjct: 408 SMLILLSSLLVLYSVLRIFIHAFWGEEKETPKPNHRTAKGLLYP 451
>GATA_NEIMB (Q9JYZ9) Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.-)| (Glu-ADT subunit A) Length = 481 Score = 28.9 bits (63), Expect = 7.9 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 13/57 (22%) Frame = -2 Query: 448 CFSFWRSSCTMKSLGNYLNSH-----------GMISL--ASQDIFPVNFSSVGSFHG 317 C + WRS+C K L N+++ + GM++L + D F + ++ SF+G Sbjct: 80 CQTGWRSACASKMLDNFISPYTATVVQNLLDEGMVTLGRTNMDEFAMGSTNENSFYG 136
>GATA_NEIMA (Q9JTZ5) Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.-)| (Glu-ADT subunit A) Length = 481 Score = 28.9 bits (63), Expect = 7.9 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 13/57 (22%) Frame = -2 Query: 448 CFSFWRSSCTMKSLGNYLNSH-----------GMISL--ASQDIFPVNFSSVGSFHG 317 C + WRS+C K L N+++ + GM++L + D F + ++ SF+G Sbjct: 80 CQTGWRSACASKMLDNFISPYTATVVQKLLDEGMVTLGRTNMDEFAMGSTNENSFYG 136 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,959,568 Number of Sequences: 219361 Number of extensions: 1381897 Number of successful extensions: 3452 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3441 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)