Clone Name | rbastl45h09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MCM3A_HUMAN (O60318) 80 kda MCM3-associated protein (GANP protein) | 28 | 8.3 |
---|
>MCM3A_HUMAN (O60318) 80 kda MCM3-associated protein (GANP protein)| Length = 1980 Score = 27.7 bits (60), Expect = 8.3 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -1 Query: 235 GPGPMWMIILKDRNVFLCTIHKKKNFRSP--PVTSLAFPDSG 116 G GP M I D + LC HK +++ P PVTS A + G Sbjct: 1731 GAGPSVMEIPWDDLIALCINHKLRDWTPPRLPVTSEALSEDG 1772 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,754,929 Number of Sequences: 219361 Number of extensions: 652199 Number of successful extensions: 1404 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1404 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)