Clone Name | rbastl45h02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CWF19_SCHPO (Q09909) Cell cycle control protein cwf19 | 33 | 0.21 | 2 | SEPP1_RAT (P25236) Selenoprotein P precursor (SeP) [Contains: Se... | 30 | 2.4 | 3 | CAUP_DROME (P54269) Homeobox protein caupolican | 29 | 5.3 |
---|
>CWF19_SCHPO (Q09909) Cell cycle control protein cwf19| Length = 639 Score = 33.5 bits (75), Expect = 0.21 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +1 Query: 322 NQTGCETFHPGTENHHHSRHGNPGHPCHFGTHRP 423 N+T ET H HHHSRH H H + RP Sbjct: 16 NETDRETNHSRRHRHHHSRHRESKHGRHDRSERP 49
>SEPP1_RAT (P25236) Selenoprotein P precursor (SeP) [Contains: Selenoprotein| Se-P10; Selenoprotein Se-P6; Selenoprotein Se-P2; Selenoprotein Se-P1] Length = 385 Score = 30.0 bits (66), Expect = 2.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 328 TGCETFHPGTENHHHSRHGNPGHPCHFGTHRP 423 T +T P E++HH H GH H G+ +P Sbjct: 193 TASKTTEPSEEHNHHKHHDKHGHE-HLGSSKP 223
>CAUP_DROME (P54269) Homeobox protein caupolican| Length = 693 Score = 28.9 bits (63), Expect = 5.3 Identities = 14/55 (25%), Positives = 20/55 (36%) Frame = +1 Query: 250 YQTSNFYRACLGSPCVHCHPL*TRNQTGCETFHPGTENHHHSRHGNPGHPCHFGT 414 Y NFY + PL Q + ++HHH H +P H G+ Sbjct: 480 YLGQNFYPPSSADQQLPHQPLQQHQQQQLQQLQQQQQHHHHPHHHHPHHSMELGS 534 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,855,298 Number of Sequences: 219361 Number of extensions: 1060346 Number of successful extensions: 3195 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3022 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3171 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)