ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl45g03 |
|---|---|
| Clone Library Name | barley_pub |
>PLDA1_TOBAC (P93400) Phospholipase D alpha 1 (EC 3.1.4.4) (PLD alpha 1)| (Choline phosphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) Length = 808 Score = 44.7 bits (104), Expect = 1e-04 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = -1 Query: 448 LPGARCFPDTQAPVLGIKSKHLPPILTT 365 LPGA FPDT+A VLG KS +LPPILTT Sbjct: 781 LPGAEHFPDTKARVLGTKSDYLPPILTT 808
>PLDA2_ARATH (Q9SSQ9) Phospholipase D alpha 2 (EC 3.1.4.4) (AtPLDalpha2) (PLD| alpha 2) (Choline phosphatase 2) (Phosphatidylcholine-hydrolyzing phospholipase D 2) Length = 810 Score = 43.9 bits (102), Expect = 2e-04 Identities = 18/28 (64%), Positives = 23/28 (82%) Frame = -1 Query: 448 LPGARCFPDTQAPVLGIKSKHLPPILTT 365 LPG FPDT+A +LG+KS ++PPILTT Sbjct: 783 LPGCEFFPDTKARILGVKSDYMPPILTT 810
>PLDA1_RICCO (Q41142) Phospholipase D alpha 1 precursor (EC 3.1.4.4) (PLD 1)| (Choline phosphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) Length = 808 Score = 43.5 bits (101), Expect = 2e-04 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -1 Query: 448 LPGARCFPDTQAPVLGIKSKHLPPILTT 365 LPG FPDT+A VLG KS +LPPILTT Sbjct: 781 LPGTEFFPDTKARVLGAKSDYLPPILTT 808
>PLDA2_ORYSA (P93844) Phospholipase D alpha 2 (EC 3.1.4.4) (PLD alpha 2)| (Choline phosphatase 2) (Phosphatidylcholine-hydrolyzing phospholipase D 2) Length = 818 Score = 42.4 bits (98), Expect = 5e-04 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = -1 Query: 448 LPGARCFPDTQAPVLGIKSKHLPPILTT 365 LPGA+ FPDTQAPV+G K +LPP LTT Sbjct: 792 LPGAKFFPDTQAPVIGTKG-NLPPFLTT 818
>PLDA1_PIMBR (O04883) Phospholipase D alpha 1 (EC 3.1.4.4) (PLD alpha 1)| (Choline phosphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) Length = 808 Score = 42.4 bits (98), Expect = 5e-04 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -1 Query: 448 LPGARCFPDTQAPVLGIKSKHLPPILTT 365 LPG FPDT+A VLG KS LPPILTT Sbjct: 781 LPGTEFFPDTKARVLGAKSDFLPPILTT 808
>PLDA1_ARATH (Q38882) Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD| alpha 1) (Choline phosphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) Length = 810 Score = 42.4 bits (98), Expect = 5e-04 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -1 Query: 448 LPGARCFPDTQAPVLGIKSKHLPPILTT 365 LPG FPDT+A +LG KS +LPPILTT Sbjct: 783 LPGFEFFPDTKARILGTKSDYLPPILTT 810
>PLDA1_MAIZE (Q43270) Phospholipase D alpha 1 (EC 3.1.4.4) (PLD alpha 1)| (Choline phosphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) Length = 812 Score = 42.0 bits (97), Expect = 7e-04 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -1 Query: 448 LPGARCFPDTQAPVLGIKSKHLPPILTT 365 LPG FPDT+A VLG KS +LPPILTT Sbjct: 785 LPGMENFPDTRARVLGNKSDYLPPILTT 812
>PLDA1_VIGUN (O04865) Phospholipase D alpha 1 (EC 3.1.4.4) (PLD alpha 1)| (Choline phosphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) Length = 809 Score = 41.2 bits (95), Expect = 0.001 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -1 Query: 448 LPGARCFPDTQAPVLGIKSKHLPPILTT 365 LPG FPDT+A +LG K+ +LPPILTT Sbjct: 782 LPGFEFFPDTKARILGAKADYLPPILTT 809
>PLDA1_ORYSA (Q43007) Phospholipase D alpha 1 precursor (EC 3.1.4.4) (PLD alpha| 1) (Choline phosphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) Length = 812 Score = 40.8 bits (94), Expect = 0.002 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -1 Query: 448 LPGARCFPDTQAPVLGIKSKHLPPILTT 365 LPG FPDT+A VLG KS ++PPILT+ Sbjct: 785 LPGMEYFPDTRARVLGAKSDYMPPILTS 812
>PLDA1_BRAOC (O82549) Phospholipase D alpha 1 precursor (EC 3.1.4.4) (PLD 1)| (Choline phosphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) Length = 810 Score = 40.8 bits (94), Expect = 0.002 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -1 Query: 445 PGARCFPDTQAPVLGIKSKHLPPILTT 365 PG FPDT+A +LG KS +LPPILTT Sbjct: 784 PGFEFFPDTKARILGTKSDYLPPILTT 810
>PLDA2_BRAOC (P55939) Phospholipase D alpha 2 precursor (EC 3.1.4.4) (PLD 2)| (Choline phosphatase 2) (Phosphatidylcholine-hydrolyzing phospholipase D 2) Length = 812 Score = 37.7 bits (86), Expect = 0.013 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -1 Query: 448 LPGARCFPDTQAPVLGIKSKHLPPILTT 365 LPG FPD++A +LG K +LPPILTT Sbjct: 785 LPGFEFFPDSKARILGNKVDYLPPILTT 812
>PLDZ1_ARATH (P58766) Phospholipase D zeta (EC 3.1.4.4) (AtPLDzeta) (PLD zeta)| Length = 820 Score = 37.4 bits (85), Expect = 0.017 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -1 Query: 448 LPGARCFPDTQAPVLGIKSKHLPPILTT 365 L G FPDT A V+G KS +LPPILT+ Sbjct: 793 LAGTEFFPDTNAKVVGEKSNYLPPILTS 820
>PLDE1_ARATH (Q9C888) Phospholipase D epsilon (EC 3.1.4.4) (AtPLDepsilon) (PLD| epsilon) (PLDalpha3) Length = 762 Score = 34.7 bits (78), Expect = 0.11 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -1 Query: 442 GARCFPDTQAPVLGIKSKHLPPILTT 365 G CFPDT+ V G +SK PP+LTT Sbjct: 737 GDGCFPDTKTLVKGKRSKMFPPVLTT 762
>BXB_CLOBO (P10844) Botulinum neurotoxin type B precursor (EC 3.4.24.69)| (BoNT/B) (Bontoxilysin B) [Contains: Botulinum neurotoxin B light chain; Botulinum neurotoxin B heavy chain] Length = 1290 Score = 31.2 bits (69), Expect = 1.2 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +2 Query: 245 LEPSYRGSNNRISLQCGKRIISS*KHHLALPRLQLCKCI 361 +E YRG N I+ Q + I K HLA+ ++Q+CK + Sbjct: 404 MEKEYRGQNKAINKQAYEEIS---KEHLAVYKIQMCKSV 439
>MATK_FROFL (Q5J309) Maturase K (Intron maturase)| Length = 505 Score = 30.0 bits (66), Expect = 2.7 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = -1 Query: 253 WF*SESIADRLT*SLNILLASLGLSYKMHT*EY*SLKIWQCFIS 122 WF E + LLAS G S MH +Y + WQC+ S Sbjct: 267 WFFKEPFPHYVRYQGKALLASKGTSLLMHKWKYYFIYFWQCYFS 310
>MATK_GOMPU (Q5J306) Maturase K (Intron maturase)| Length = 505 Score = 29.3 bits (64), Expect = 4.6 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 202 LLASLGLSYKMHT*EY*SLKIWQCFIS 122 LLAS G S MH +Y + WQC+ S Sbjct: 284 LLASKGTSLLMHKWKYYFISFWQCYFS 310
>MATK_GOMHA (Q5J308) Maturase K (Intron maturase)| Length = 505 Score = 29.3 bits (64), Expect = 4.6 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 202 LLASLGLSYKMHT*EY*SLKIWQCFIS 122 LLAS G S MH +Y + WQC+ S Sbjct: 284 LLASKGTSLLMHKWKYYFISFWQCYFS 310
>YEIA_ECOLI (P25889) Hypothetical protein yeiA| Length = 411 Score = 28.5 bits (62), Expect = 7.9 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +2 Query: 317 KHHLALPRLQLCKCILCGENRGQVFGFDSKHRSLRVGEAPRT 442 + ++ PR+ L KC+ CG R + +D H+++ E RT Sbjct: 331 RSYIVYPRINLDKCVGCG--RCYISCYDGGHQAMEWSEKTRT 370
>MATK_GRABR (Q95EE5) Maturase K (Intron maturase)| Length = 510 Score = 28.5 bits (62), Expect = 7.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 202 LLASLGLSYKMHT*EY*SLKIWQCFIS 122 +LAS G S MH +Y + WQC+ S Sbjct: 289 ILASKGTSLLMHKWKYYLINFWQCYFS 315 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,510,028 Number of Sequences: 219361 Number of extensions: 1026780 Number of successful extensions: 2207 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 2177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2206 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
