Clone Name | rbastl45e11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VGNM_BPMV (P23009) Genome polyprotein M (RNA2 polyprotein) [Cont... | 30 | 1.8 | 2 | GERXB_BACAN (Q9ZFB5) Spore germination protein XB | 28 | 6.9 | 3 | INCE_CHICK (P53352) Inner centromere protein | 28 | 6.9 | 4 | FUTSC_DROME (Q9W596) Microtubule-associated protein futsch | 27 | 9.0 |
---|
>VGNM_BPMV (P23009) Genome polyprotein M (RNA2 polyprotein) [Contains:| Movement protein (MP); Large coat protein (LCP) (Coat protein VP37); Small coat protein (SCP) (Coat protein VP23)] Length = 1018 Score = 29.6 bits (65), Expect = 1.8 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 18 NKPLSQLEKQASWEENCLVVQTVYIGD 98 N P+S L + A+W++ CL+V+ V G+ Sbjct: 873 NSPISNLLRVAAWKKGCLMVKVVMSGN 899
>GERXB_BACAN (Q9ZFB5) Spore germination protein XB| Length = 355 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 5/42 (11%) Frame = +3 Query: 210 GKNSIQHITGIVLP-----SLFCQLKD*SQRERSLLKPLAEH 320 G SI TGI+LP F + + ++ SLLKP+ EH Sbjct: 131 GVQSIALTTGILLPVVFLLGFFVMIANFPHKDYSLLKPIMEH 172
>INCE_CHICK (P53352) Inner centromere protein| Length = 877 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 357 PSEKDKQPAESS--DAQPVA*AENVLSDFSPSAGKTGK 250 PS DK P ESS ++QP+ A ++ +P A GK Sbjct: 188 PSSDDKSPKESSAAESQPLPAASELIVPHTPEAKGAGK 225
>FUTSC_DROME (Q9W596) Microtubule-associated protein futsch| Length = 5412 Score = 27.3 bits (59), Expect = 9.0 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = -2 Query: 390 EAEVRRTMKRRPSEKDKQPAESSDA-QPVA*AENVLSDFSPSAGKTGKEARYR*YVELSS 214 EAE + RR S +K P S +A +P + AE+V + A K+ +E+R E S Sbjct: 3775 EAEKSKEESRRESVAEKSPLASKEASRPASVAESVKDE----AEKSKEESRRESVAEKSP 3830 Query: 213 CPKR 202 P + Sbjct: 3831 LPSK 3834 Score = 27.3 bits (59), Expect = 9.0 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -2 Query: 390 EAEVRRTMKRRPSEKDKQPAESSDA-QPVA*AENVLSDFSPSAGKTGKEA 244 EAE + RR S +K P S +A +P + AE+V D S ++ +E+ Sbjct: 3627 EAEKSKEESRRESVAEKSPLASKEASRPASVAESVKDDAEKSKEESRRES 3676 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,487,273 Number of Sequences: 219361 Number of extensions: 841848 Number of successful extensions: 2206 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2206 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)