Clone Name | rbastl45e02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IF140_HUMAN (Q96RY7) Intraflagellar transport 140 homolog (WD an... | 30 | 2.4 | 2 | SIA4B_RAT (Q11205) CMP-N-acetylneuraminate-beta-galactosamide-al... | 30 | 2.4 | 3 | TAB3_XENLA (Q7ZXH3) Mitogen-activated protein kinase kinase kina... | 30 | 3.2 | 4 | PYR5_FREDI (P11401) Phycobilisome 37.5 kDa linker polypeptide, p... | 30 | 3.2 |
---|
>IF140_HUMAN (Q96RY7) Intraflagellar transport 140 homolog (WD and| tetratricopeptide repeats protein 2) Length = 1462 Score = 30.0 bits (66), Expect = 2.4 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -1 Query: 428 ERTMHGHIPQQLAVLVAGPNL*NQCILGVHVA 333 ER M H QQ+A + P+L N C L VA Sbjct: 406 ERAMSSHFHQQVAAMQVSPSLLNVCFLSTGVA 437
>SIA4B_RAT (Q11205) CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,| 3-sialyltransferase (EC 2.4.99.-) (Beta-galactoside alpha-2,3-sialyltransferase) (Alpha 2,3-ST) (Gal-NAc6S) (Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase) (ST3GALA.2) (SIAT4-B) (ST3 Length = 350 Score = 30.0 bits (66), Expect = 2.4 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 312 GTAEWYNSHMDSKYALISEIWT 377 GT+EW++SH DS IS +WT Sbjct: 80 GTSEWFDSHFDSN---ISPVWT 98
>TAB3_XENLA (Q7ZXH3) Mitogen-activated protein kinase kinase kinase| 7-interacting protein 3 homolog Length = 692 Score = 29.6 bits (65), Expect = 3.2 Identities = 8/25 (32%), Positives = 18/25 (72%) Frame = +1 Query: 142 IPECFLQDHSDTSVCYKRIQEQNCK 216 + +C LQ++S+ CY+ + +++CK Sbjct: 28 VSQCMLQNNSNLDACYRALTQESCK 52
>PYR5_FREDI (P11401) Phycobilisome 37.5 kDa linker polypeptide,| phycocyanin-associated, rod (L-37.5/R) Length = 268 Score = 29.6 bits (65), Expect = 3.2 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = +2 Query: 173 IHQYVTKEYRNKTAKLLHDHQQHNLCGYRY*PHIYALQLSP*RRTVGYSRMVQ 331 ++ Y K Y + + + G R PH + P ++TVG++RM Q Sbjct: 114 VNLYTEKGYEAEINSYIDSAEYQESFGERIVPHYRGFETQPGQKTVGFNRMFQ 166 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,704,093 Number of Sequences: 219361 Number of extensions: 1200291 Number of successful extensions: 2567 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2566 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)