Clone Name | rbastl45d11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2 | 39 | 0.003 | 2 | UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1 | 39 | 0.003 | 3 | UBE13_WHEAT (P31252) Ubiquitin-activating enzyme E1 3 | 35 | 0.060 | 4 | UVRC_RALSO (Q8Y0H3) UvrABC system protein C (Protein uvrC) (Exci... | 27 | 9.6 | 5 | IF4E2_ARATH (O04663) Eukaryotic translation initiation factor 4E... | 27 | 9.6 |
---|
>UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2| Length = 1051 Score = 38.9 bits (89), Expect = 0.003 Identities = 21/35 (60%), Positives = 21/35 (60%) Frame = -1 Query: 344 KMEVPSYRRHLXXXXXXXXXXXXXXDIPLVSVYFR 240 KMEVPSYRRHL DIPLVSVYFR Sbjct: 1017 KMEVPSYRRHLDVVVACEDDDDNDVDIPLVSVYFR 1051
>UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1| Length = 1051 Score = 38.9 bits (89), Expect = 0.003 Identities = 21/35 (60%), Positives = 21/35 (60%) Frame = -1 Query: 344 KMEVPSYRRHLXXXXXXXXXXXXXXDIPLVSVYFR 240 KMEVPSYRRHL DIPLVSVYFR Sbjct: 1017 KMEVPSYRRHLDVVVACEDDDDNDVDIPLVSVYFR 1051
>UBE13_WHEAT (P31252) Ubiquitin-activating enzyme E1 3| Length = 1053 Score = 34.7 bits (78), Expect = 0.060 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = -1 Query: 344 KMEVPSYRRHLXXXXXXXXXXXXXXDIPLVSVYFR 240 K++VP YRRHL DIPLVSVYFR Sbjct: 1019 KVDVPEYRRHLDIGVACEDEDENDVDIPLVSVYFR 1053
>UVRC_RALSO (Q8Y0H3) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 654 Score = 27.3 bits (59), Expect = 9.6 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 264 DVDIVVIVILTGHHDVEMTPVRGHLHL 344 D+DI+ + I GH V + VRG HL Sbjct: 268 DIDILAVAIKGGHACVNLAMVRGGRHL 294
>IF4E2_ARATH (O04663) Eukaryotic translation initiation factor 4E-2 (eIF4E-2)| (eIF-4E-2) (mRNA cap-binding protein) (eIF-(iso)4F 25 kDa subunit) (eIF-(iso)4F p28 subunit) (eIF4Eiso protein) (eIF(iso)4E) Length = 198 Score = 27.3 bits (59), Expect = 9.6 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 86 DHWGLIWSCYQTSRFTRHAQHHL 18 D WGL + +QTS+ T +A+ HL Sbjct: 61 DFWGLHETIFQTSKLTANAEIHL 83 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,151,164 Number of Sequences: 219361 Number of extensions: 716773 Number of successful extensions: 1206 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1195 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1206 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)