Clone Name | rbastl45d07 |
---|---|
Clone Library Name | barley_pub |
>NBR1_PONPY (Q5RC94) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) Length = 894 Score = 34.3 bits (77), Expect = 0.14 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = -1 Query: 404 LLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIAREKKD 282 L+A L EMGF DR+ N +LL K+ +I + V +L+ D Sbjct: 848 LMAHLFEMGFCDRQLNLQLLKKHNYNILQVVTELLQLNNND 888
>DSK2_SCHPO (Q10169) Deubiquitination-protection protein dph1| Length = 354 Score = 33.9 bits (76), Expect = 0.18 Identities = 14/35 (40%), Positives = 26/35 (74%) Frame = -1 Query: 401 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIA 297 L++L+EMGF D E N + L ++GG+++ A+ L++ Sbjct: 318 LSQLNEMGFVDFERNVQALRRSGGNVQGAIESLLS 352
>NBR1_RAT (Q501R9) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) Length = 983 Score = 33.5 bits (75), Expect = 0.24 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = -1 Query: 404 LLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIAREKKD 282 L+A L EMGF DR+ N LL K+ +I + V +L+ D Sbjct: 937 LMAHLFEMGFCDRQLNLRLLRKHNHNILQVVTELLQVNNND 977
>NBR1_HUMAN (Q14596) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) (Membrane component, chromosome 17, surface marker 2) (1A1-3B) Length = 966 Score = 33.5 bits (75), Expect = 0.24 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = -1 Query: 404 LLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIAREKKD 282 L+A L EMGF DR+ N LL K+ +I + V +L+ D Sbjct: 920 LMARLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNND 960
>NBR1_MOUSE (P97432) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) (Membrane component, chromosome 17, surface marker 2) Length = 988 Score = 33.1 bits (74), Expect = 0.31 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = -1 Query: 404 LLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIAREKKD 282 L+A L EMGF DR+ N LL K+ +I + V +L+ D Sbjct: 942 LMAHLFEMGFCDRQLNLRLLRKHNYNILQVVTELLQVNNND 982
>UBL7_MOUSE (Q91W67) Ubiquitin-like protein 7 (Ubiquitin-like protein SB132)| Length = 380 Score = 31.2 bits (69), Expect = 1.2 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 419 NEWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAV 312 ++W P L +L +MG D E + L GG I+ A+ Sbjct: 336 SQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAAL 371
>UBL7_HUMAN (Q96S82) Ubiquitin-like protein 7 (Ubiquitin-like protein SB132)| (Bone marrow stromal cell ubiquitin-like protein) (BMSC-UbP) Length = 380 Score = 31.2 bits (69), Expect = 1.2 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 419 NEWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAV 312 ++W P L +L +MG D E + L GG I+ A+ Sbjct: 336 SQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAAL 371
>UBQL1_RAT (Q9JJP9) Ubiquilin-1 (Protein linking IAP with cytoskeleton 1)| (PLIC-1) Length = 582 Score = 30.8 bits (68), Expect = 1.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 401 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIARE 291 L +LS MGF +RE N + L GG I A+ L+ + Sbjct: 544 LEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQ 580
>UBQL1_MOUSE (Q8R317) Ubiquilin-1 (Protein linking IAP with cytoskeleton 1)| (PLIC-1) Length = 582 Score = 30.8 bits (68), Expect = 1.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 401 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIARE 291 L +LS MGF +RE N + L GG I A+ L+ + Sbjct: 544 LEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQ 580
>UBQL1_HUMAN (Q9UMX0) Ubiquilin-1 (Protein linking IAP with cytoskeleton 1)| (PLIC-1) (hPLIC-1) Length = 589 Score = 30.8 bits (68), Expect = 1.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 401 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIARE 291 L +LS MGF +RE N + L GG I A+ L+ + Sbjct: 551 LEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQ 587
>FOXJ3_MOUSE (Q8BUR3) Forkhead box protein J3| Length = 623 Score = 30.8 bits (68), Expect = 1.5 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 79 EQLSRLQQPHAADPPRSQHNKVHTAHRSHT 168 +Q S+LQ PH+ PP QH + H H+ T Sbjct: 406 QQHSQLQPPHSQHPPPHQHIQHHPNHQHQT 435
>UN13B_HUMAN (O14795) Unc-13 homolog B (Munc13-2) (munc13)| Length = 1591 Score = 30.8 bits (68), Expect = 1.5 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 73 GTEQLSRLQQPHAADPPRSQHNKVHTAHRSHT 168 G+ QLS L Q H D + + +H+ H SH+ Sbjct: 270 GSSQLSELDQYHEQDDDHRETDSIHSCHSSHS 301
>GTS1_YEAST (P40956) Protein GTS1 (Protein LSR1)| Length = 396 Score = 30.8 bits (68), Expect = 1.5 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 401 LAELSEMGFDDRETNKELLAKNGGSIKRAV 312 LAEL +MGF D N + L+ G+I RA+ Sbjct: 199 LAELKDMGFGDTNKNLDALSSAHGNINRAI 228
>UBQL4_HUMAN (Q9NRR5) Ubiquilin-4 (Ataxin-1 ubiquitin-like-interacting protein| A1U) Length = 601 Score = 30.4 bits (67), Expect = 2.0 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 401 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIARE 291 L +L+ MGF +RE N + L GG I A+ L+ + Sbjct: 563 LEQLNSMGFINREANLQALIATGGDINAAIERLLGSQ 599
>UBQL4_MOUSE (Q99NB8) Ubiquilin-4 (Ataxin-1 ubiquitin-like-interacting protein| A1U) Length = 596 Score = 30.4 bits (67), Expect = 2.0 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 401 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIARE 291 L +L+ MGF +RE N + L GG I A+ L+ + Sbjct: 558 LEQLNSMGFINREANLQALIATGGDINAAIERLLGSQ 594
>UBQL2_MOUSE (Q9QZM0) Ubiquilin-2 (Protein linking IAP with cytoskeleton 2)| (PLIC-2) (Ubiquitin-like product Chap1/Dsk2) (DSK2 homolog) (Chap1) Length = 638 Score = 29.6 bits (65), Expect = 3.4 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 401 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIARE 291 L +L+ MGF +RE N + L GG I A+ L+ + Sbjct: 600 LEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQ 636
>UBQL2_HUMAN (Q9UHD9) Ubiquilin-2 (Protein linking IAP with cytoskeleton 2)| (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2) (DSK2 homolog) (Chap1) Length = 624 Score = 29.6 bits (65), Expect = 3.4 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 401 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIARE 291 L +L+ MGF +RE N + L GG I A+ L+ + Sbjct: 586 LEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQ 622
>UBIB_PSESM (Q87UZ0) Probable ubiquinone biosynthesis protein ubiB| Length = 539 Score = 29.6 bits (65), Expect = 3.4 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +1 Query: 85 LSRLQQPHAADPPRSQHNK 141 L R+ +PHA+DPPR H++ Sbjct: 468 LERMSRPHASDPPRPWHDR 486
>DSK2_YEAST (P48510) Ubiquitin domain-containing protein DSK2| Length = 373 Score = 29.3 bits (64), Expect = 4.4 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = -1 Query: 401 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDLI 300 L +L++MGF D + N L ++GGS++ A+ L+ Sbjct: 336 LRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLL 369
>SIN1_SCHPO (Q9P7Y9) Stress-activated map kinase-interacting protein 1| (SAPK-interacting protein 1) Length = 665 Score = 29.3 bits (64), Expect = 4.4 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 8/51 (15%) Frame = +1 Query: 88 SRLQQPHAADPPRSQH--------NKVHTAHRSHTNKSSQQFIGKLRDTLS 216 +++++ AA P +S+H NK H H S T+ SQ+ ++DTL+ Sbjct: 386 AQIKENQAAYPFKSKHPTSIPEANNKTHIRHTSSTSSQSQKQAQDVKDTLN 436
>Y3539_METJA (Q60294) Hypothetical UPF0252 protein MJECL39| Length = 351 Score = 28.9 bits (63), Expect = 5.8 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 14/88 (15%) Frame = -2 Query: 268 ELSNTYLSISIYICLNNE-TVCPVVCL*TAVKTCWCD--FCVR-------CELYYVVTVV 119 E SN Y I+ +I + + P V L WC+ FC+ C LY+++T++ Sbjct: 51 EKSNVYYFITFFIIVGLVWAIFPEVWL-------WCEQVFCISPTIHIIICCLYFIITII 103 Query: 118 GQLRVVAVIG----LVALFLLFNYCEWK 47 L + V+G L A F + C+ K Sbjct: 104 LFLFLCGVVGTFLHLWATFFTLSKCDSK 131
>HRP1_YEAST (Q99383) Nuclear polyadenylated RNA-binding protein 4 (Cleavage| factor IB) (CFIB) Length = 534 Score = 28.9 bits (63), Expect = 5.8 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 7/59 (11%) Frame = +1 Query: 79 EQLSRLQQPHAADPPRSQ--HNKVHTAHRSHTNKSSQQFIGKL-----RDTLSRYLGIY 234 + +S+ QQP + PP+ Q K + + +S + FIG L D L Y G Y Sbjct: 124 QTMSQFQQPSSQSPPQQQVTQTKEERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKY 182
>SAHH_YEAST (P39954) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 449 Score = 28.9 bits (63), Expect = 5.8 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 6/60 (10%) Frame = +3 Query: 264 SSRSSLVLLLPGDEVH------HSSFDASSILGKQLLVRLPVIKSHFAQFRQQRVPFIDT 425 SS ++LL G V+ HSSF S Q+L ++ + KS+ FR++ + F T Sbjct: 334 SSGRHVILLANGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKSNDKSFREKHIEFQKT 393
>KNOX3_MAIZE (P56661) Homeobox protein knotted-1-like 3 (Fragment)| Length = 88 Score = 28.5 bits (62), Expect = 7.6 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 374 DDRETNKELLAKNGGSIKRAVMDLIAREKKDK 279 DD+E K+LL K G + +L + KKDK Sbjct: 1 DDKELKKQLLRKYSGCLGNLRKELCKKRKKDK 32
>UBQL3_HUMAN (Q9H347) Ubiquilin-3| Length = 655 Score = 28.1 bits (61), Expect = 9.9 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -1 Query: 401 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDL 303 L +L MGF +RE N + L GG + AV L Sbjct: 620 LEQLRSMGFLNREANLQALIATGGDVDAAVEKL 652
>PMEU1_LYCES (Q43143) Pectinesterase U1 precursor (EC 3.1.1.11) (Pectin| methylesterase) (PE) Length = 583 Score = 28.1 bits (61), Expect = 9.9 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -2 Query: 163 DFCVRCELYYVVTVVGQLRVVAVIGLVA 80 DFC R + Y+ V L V AVIG+VA Sbjct: 13 DFCKRKKKIYLAIVASVLLVAAVIGVVA 40
>DT3E_PSECI (O50580) D-tagatose 3-epimerase (EC 5.3.1.-)| Length = 290 Score = 28.1 bits (61), Expect = 9.9 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 413 WDPLLAELSEMGFDDRETNKELLAKNGGSIKRAV 312 WD + L E+G+D + + K GGS+ RAV Sbjct: 227 WDEIFGALKEIGYDGTIVMEPFMRK-GGSVSRAV 259 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,400,811 Number of Sequences: 219361 Number of extensions: 1154077 Number of successful extensions: 3149 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 3058 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3147 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)