Clone Name | rbastl45d05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZNF21_MOUSE (Q6P560) Zinc finger protein 21 | 31 | 1.8 | 2 | ZG28_XENLA (P18716) Gastrula zinc finger protein XLCGF28.1 (Frag... | 30 | 3.0 | 3 | ZN441_HUMAN (Q8N8Z8) Zinc finger protein 441 | 30 | 3.9 | 4 | ZSCA2_HUMAN (Q7Z7L9) Zinc finger and SCAN domain-containing prot... | 30 | 3.9 | 5 | ZN256_HUMAN (Q9Y2P7) Zinc finger protein 256 (Bone marrow zinc f... | 29 | 6.7 | 6 | ZN567_HUMAN (Q8N184) Zinc finger protein 567 | 29 | 6.7 | 7 | SELI_PONPY (Q5NV96) Selenoprotein I | 29 | 6.7 | 8 | SELI_HUMAN (Q9C0D9) Selenoprotein I | 29 | 6.7 |
---|
>ZNF21_MOUSE (Q6P560) Zinc finger protein 21| Length = 627 Score = 30.8 bits (68), Expect = 1.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -2 Query: 286 VHCRALIGVRSVRCSECALCHDEKFQFLVFIRSYT 182 VH R G + CSEC +K Q ++ +R++T Sbjct: 252 VHWRTHTGEKPFECSECGKAFSQKSQLIIHLRTHT 286
>ZG28_XENLA (P18716) Gastrula zinc finger protein XLCGF28.1 (Fragment)| Length = 252 Score = 30.0 bits (66), Expect = 3.0 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 2/57 (3%) Frame = -2 Query: 286 VHCRALIGVRSVRCSECALCHDEKFQFLVFIRSYTSS--FLFLNCLYEF*CNQFRNV 122 +H R+ G +S C+ C QF V +RS+T F C F CN N+ Sbjct: 79 IHIRSHTGDKSYTCTVCGKIFTRISQFNVHVRSHTGEKPFKCTECGKSFICNSQLNL 135
>ZN441_HUMAN (Q8N8Z8) Zinc finger protein 441| Length = 626 Score = 29.6 bits (65), Expect = 3.9 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 6/71 (8%) Frame = -2 Query: 427 DLSRSISDLQCWFRLDLLRDDSEHKHLEKIILGSTNWRHSEC*MV------PEVHCRALI 266 D+ S L C+ R+D SEHK E G + H++C ++H R Sbjct: 43 DVLMGRSSLNCYIRVD-----SEHKPYEYQEYGEKPYTHTQCGTAFSYQPCFQIHERPQH 97 Query: 265 GVRSVRCSECA 233 G + C ECA Sbjct: 98 GKKLYDCKECA 108
>ZSCA2_HUMAN (Q7Z7L9) Zinc finger and SCAN domain-containing protein 2 (Zinc| finger protein 29 homolog) (Zfp-29) Length = 613 Score = 29.6 bits (65), Expect = 3.9 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 283 HCRALIGVRSVRCSECALCHDEKFQFLVFIRSYT 182 H R G + +CSEC C ++ Q +V R++T Sbjct: 491 HQRIHTGEKPYKCSECGKCFSQRSQLVVHQRTHT 524
>ZN256_HUMAN (Q9Y2P7) Zinc finger protein 256 (Bone marrow zinc finger 3)| (BMZF-3) Length = 474 Score = 28.9 bits (63), Expect = 6.7 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 283 HCRALIGVRSVRCSECALCHDEKFQFLVFIRSYT 182 H R GVRS C EC KF +V R +T Sbjct: 272 HQRVHTGVRSHECHECGKLFSRKFDLIVHERVHT 305
>ZN567_HUMAN (Q8N184) Zinc finger protein 567| Length = 616 Score = 28.9 bits (63), Expect = 6.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 283 HCRALIGVRSVRCSECALCHDEKFQFLVFIRSYT 182 H R G + +CSEC C +K +V R++T Sbjct: 548 HQRTHTGEKPYKCSECGKCFRQKTNLIVHQRTHT 581
>SELI_PONPY (Q5NV96) Selenoprotein I| Length = 397 Score = 28.9 bits (63), Expect = 6.7 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -2 Query: 238 CALCHDEKFQFLVFIRSYTSSFLFLNCLYE 149 CALC L F RSY ++ L LN +YE Sbjct: 229 CALCVTLPMSLLNFFRSYKNNTLKLNSVYE 258
>SELI_HUMAN (Q9C0D9) Selenoprotein I| Length = 397 Score = 28.9 bits (63), Expect = 6.7 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -2 Query: 238 CALCHDEKFQFLVFIRSYTSSFLFLNCLYE 149 CALC L F RSY ++ L LN +YE Sbjct: 229 CALCVTLPMSLLNFFRSYKNNTLKLNSVYE 258 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,624,850 Number of Sequences: 219361 Number of extensions: 1089816 Number of successful extensions: 2651 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2651 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)