Clone Name | rbastl45d02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | S6A18_HUMAN (Q96N87) Sodium- and chloride-dependent transporter ... | 30 | 3.2 | 2 | MATK_HELBU (Q9XPN6) Maturase K (Intron maturase) | 29 | 4.1 | 3 | YN60_YEAST (P42840) Hypothetical 32.3 kDa protein in KRE1-HXT14 ... | 28 | 7.1 | 4 | PGLR_MALDO (P48978) Polygalacturonase precursor (EC 3.2.1.15) (P... | 28 | 9.2 | 5 | HME2_CHICK (Q05917) Homeobox protein engrailed-2 (Gg-En-2) | 28 | 9.2 |
---|
>S6A18_HUMAN (Q96N87) Sodium- and chloride-dependent transporter XTRP2 (Solute| carrier family 6 member 18) Length = 628 Score = 29.6 bits (65), Expect = 3.2 Identities = 16/61 (26%), Positives = 26/61 (42%) Frame = -1 Query: 262 IQRWCWSDEAIGQLCFVSYLHSTCIFPKENNVWDKCSHFWLG*IYSIHISLKFYMLMFVS 83 + RW + G +C V +L +TC + N +WL + SL ML F+ Sbjct: 435 LPRWVPKEALTGLVCLVCFLSATCFTLQSGN-------YWLEIFDNFAASLNLLMLAFLE 487 Query: 82 I 80 + Sbjct: 488 V 488
>MATK_HELBU (Q9XPN6) Maturase K (Intron maturase)| Length = 515 Score = 29.3 bits (64), Expect = 4.1 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -1 Query: 172 NVWDKCSHFWLG*IYSIHIS----LKFYMLMFVSIPTIRPESVRLAYILNLFI 26 N W +FW Y IHI+ FY + ++S I P +V+ + NLF+ Sbjct: 309 NFWQYYLYFWSK-PYRIHINQLSNYSFYFMGYISSVLINPSAVKNQMLENLFL 360
>YN60_YEAST (P42840) Hypothetical 32.3 kDa protein in KRE1-HXT14 intergenic| region Length = 284 Score = 28.5 bits (62), Expect = 7.1 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = -2 Query: 396 ILSIQIYGSLHASEYEK-IVHDVPPPHSHRITDIFSFRRSRPLYGSFKGGAGQMKL*DNF 220 I S + YG+ S EK + D SH TD F +R LYG GGA + + F Sbjct: 111 IYSYRGYGNSEGSPSEKGLKLDADCVISHLSTDSFHSKRKLVLYGRSLGGANALYIASKF 170
>PGLR_MALDO (P48978) Polygalacturonase precursor (EC 3.2.1.15) (PG) (Pectinase)| Length = 460 Score = 28.1 bits (61), Expect = 9.2 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -2 Query: 423 VKVGAPEKKILSIQIYGSLHASEYEKIVHDV 331 ++ P K L++QIYG++ ASE I D+ Sbjct: 145 IEFSGPCKSQLTLQIYGTIEASEDRSIYKDI 175
>HME2_CHICK (Q05917) Homeobox protein engrailed-2 (Gg-En-2)| Length = 288 Score = 28.1 bits (61), Expect = 9.2 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -2 Query: 330 PPPHSHRITDIFSFRRSRPLYGSFKGGAG 244 P PH HRIT+ F RP +G K G Sbjct: 41 PHPHPHRITNFFIDNILRPEFGRRKEAGG 69 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,981,907 Number of Sequences: 219361 Number of extensions: 1158241 Number of successful extensions: 2269 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2232 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2269 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)