Clone Name | rbastl45c08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AOR_PYRAB (Q9V035) Tungsten-containing aldehyde ferredoxin oxido... | 29 | 5.8 | 2 | AOR_PYRHO (O58778) Tungsten-containing aldehyde ferredoxin oxido... | 28 | 7.6 |
---|
>AOR_PYRAB (Q9V035) Tungsten-containing aldehyde ferredoxin oxidoreductase (EC| 1.2.7.5) Length = 607 Score = 28.9 bits (63), Expect = 5.8 Identities = 15/54 (27%), Positives = 30/54 (55%) Frame = -1 Query: 422 QASFEAVSSSILIQCQRCFSSPVKCGITLFAVHL*ELKL*EPMF*RSWAVHVNI 261 + S EA+++ LI+ + CF+ P+ CG + + E + P + +WA+ N+ Sbjct: 271 EQSGEAMAAKYLIRNKPCFACPIGCGRVNYLPSIGETE--GPEYESTWALGANL 322
>AOR_PYRHO (O58778) Tungsten-containing aldehyde ferredoxin oxidoreductase (EC| 1.2.7.5) Length = 607 Score = 28.5 bits (62), Expect = 7.6 Identities = 14/54 (25%), Positives = 30/54 (55%) Frame = -1 Query: 422 QASFEAVSSSILIQCQRCFSSPVKCGITLFAVHL*ELKL*EPMF*RSWAVHVNI 261 + S EA+++ L++ + CF+ P+ CG + + E + P + +WA+ N+ Sbjct: 271 EQSGEAMAAKYLVRNKPCFACPIGCGRVNYLPSIGETE--GPEYESTWALGANL 322 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,223,268 Number of Sequences: 219361 Number of extensions: 1228516 Number of successful extensions: 2333 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2333 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)