Clone Name | rbastl45c07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ENV_FIVT2 (Q02282) Env polyprotein (GP150 polyprotein) [Contains... | 29 | 4.0 | 2 | HIS5_PROMT (Q46JZ5) Imidazole glycerol phosphate synthase subuni... | 28 | 6.9 |
---|
>ENV_FIVT2 (Q02282) Env polyprotein (GP150 polyprotein) [Contains: Major| glycoprotein GP100; Glycoprotein GP36] Length = 855 Score = 29.3 bits (64), Expect = 4.0 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 98 STYDCYSRGGDKLQFGCHPLRKKKEGKLLFRVR 196 S+ D Y G ++FGCH + K+ + FR+R Sbjct: 429 SSSDYYDVQGAWIEFGCHRNKSKRHSEARFRIR 461
>HIS5_PROMT (Q46JZ5) Imidazole glycerol phosphate synthase subunit hisH (EC| 2.4.2.-) (IGP synthase glutamine amidotransferase subunit) (IGP synthase subunit hisH) (ImGP synthase subunit hisH) (IGPS subunit hisH) Length = 209 Score = 28.5 bits (62), Expect = 6.9 Identities = 18/62 (29%), Positives = 24/62 (38%) Frame = +2 Query: 209 H*HRPCPVQADSNLLTLSFGKITEEGSPVP*LHNTQGRCDIQPRAQMLAIAYDSFPWHPW 388 H + CP++ + FGK T+ S V H G C P +A F W W Sbjct: 147 HSYSACPLEPKHTVAVTKFGK-TDVSSMV--WHKNTGACQFHPEKSGVAGQKIIFNWINW 203 Query: 389 CK 394 K Sbjct: 204 LK 205 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,966,444 Number of Sequences: 219361 Number of extensions: 1434021 Number of successful extensions: 3337 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3337 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)