| Clone Name | rbastl45c04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TAOK3_PONPY (Q5R4F3) Serine/threonine-protein kinase TAO3 (EC 2.... | 29 | 2.3 | 2 | TAOK3_HUMAN (Q9H2K8) Serine/threonine-protein kinase TAO3 (EC 2.... | 29 | 2.3 | 3 | RAPD_BACSU (P94583) Response regulator aspartate phosphatase D (... | 28 | 4.0 | 4 | MYSA_DROME (P05661) Myosin heavy chain, muscle | 28 | 5.2 | 5 | FA18_ARATH (Q8LEK2) FAM18-like protein At1g09330 | 28 | 6.8 |
|---|
>TAOK3_PONPY (Q5R4F3) Serine/threonine-protein kinase TAO3 (EC 2.7.11.1)| (Thousand and one amino acid protein 3) Length = 898 Score = 29.3 bits (64), Expect = 2.3 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = +1 Query: 229 EPMELLQAHNITKGALHGFGYIRT--TIRRQLRQGLEL*YQPG 351 +P++ ++ IT GALHG Y+ + I R ++ G L +PG Sbjct: 117 KPLQEVEIAAITHGALHGLAYLHSHALIHRDIKAGNILLTEPG 159
>TAOK3_HUMAN (Q9H2K8) Serine/threonine-protein kinase TAO3 (EC 2.7.11.1)| (Thousand and one amino acid protein 3) (Jun kinase-inhibitory kinase) (JNK/SAPK-inhibitory kinase) (Dendritic cell-derived protein kinase) (Cutaneous T-cell lymphoma tumor antigen H Length = 898 Score = 29.3 bits (64), Expect = 2.3 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = +1 Query: 229 EPMELLQAHNITKGALHGFGYIRT--TIRRQLRQGLEL*YQPG 351 +P++ ++ IT GALHG Y+ + I R ++ G L +PG Sbjct: 117 KPLQEVEIAAITHGALHGLAYLHSHALIHRDIKAGNILLTEPG 159
>RAPD_BACSU (P94583) Response regulator aspartate phosphatase D (EC 3.1.-.-)| Length = 354 Score = 28.5 bits (62), Expect = 4.0 Identities = 23/90 (25%), Positives = 36/90 (40%), Gaps = 3/90 (3%) Frame = +1 Query: 58 ELQQYKYMFSSLFVIIRVGVL**MTHIKGGIRLFLLVYNEINLKPTLKSQAE*GYFPEPM 237 EL+ Y Y FS L+ +++ + H K + ++N L Q Y+ Sbjct: 87 ELKYYLYFFSGLYEMVKTAPKHAVHHFKKAEQYLAAIHNTFE-AADLYYQTAGAYYLMKS 145 Query: 238 ELLQAHNITKGA---LHGFGYIRTTIRRQL 318 L + K LH FGYI+ I +L Sbjct: 146 PPLSVQYVKKALHIYLHQFGYIKKVITCKL 175
>MYSA_DROME (P05661) Myosin heavy chain, muscle| Length = 1962 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +1 Query: 13 LDCPDERADQFIHCTELQQYKYMFSSLFVIIRVGVL 120 LDCP + + I TEL + Y V R GVL Sbjct: 734 LDCPKKASKVLIESTELNEDLYRLGHTKVFFRAGVL 769
>FA18_ARATH (Q8LEK2) FAM18-like protein At1g09330| Length = 186 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/49 (22%), Positives = 22/49 (44%) Frame = -2 Query: 387 WC*WWTHHF*IGSWLIL*LKALTQLSSDGGSYISEAMQCPLGNVVSLEK 241 W WWT + +W IL + +L + +D + + + N++ K Sbjct: 106 WLFWWTLYLAAAAWFILGVFSLIRFQADYLLVVGVCLSLNVANIIGFTK 154 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,808,641 Number of Sequences: 219361 Number of extensions: 1239399 Number of successful extensions: 2470 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2470 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)