Clone Name | rbastl45b10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RPM1_CAEEL (Q17551) Ubiquitin ligase protein rpm-1 (EC 6.3.2.-) ... | 32 | 0.54 | 2 | PLCG1_RAT (P10686) 1-phosphatidylinositol-4,5-bisphosphate phosp... | 28 | 7.8 | 3 | NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 pr... | 28 | 7.8 | 4 | NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 pr... | 28 | 7.8 |
---|
>RPM1_CAEEL (Q17551) Ubiquitin ligase protein rpm-1 (EC 6.3.2.-)| (Pam/highwire/rpm-1 protein) (Regulator of presynaptic morphology protein 1) (Synapse defective protein 3) Length = 3766 Score = 31.6 bits (70), Expect = 0.54 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 118 DPSCTHPYCLNYSRTGTTLCHTHTH 192 D +CTH C+NY++T + HT H Sbjct: 3463 DGTCTHEDCVNYAKTACQVMHTCNH 3487
>PLCG1_RAT (P10686) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase| gamma 1 (EC 3.1.4.11) (Phosphoinositide phospholipase C) (PLC-gamma-1) (Phospholipase C-gamma-1) (PLC-II) (PLC-148) Length = 1290 Score = 27.7 bits (60), Expect = 7.8 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +1 Query: 4 PEGTSHHRLHYWAKQGIFSAHDDALTGSQLS*ASACRSDPSCTHPYC 144 PE ++ HYW I S+H+ LTG Q S S+ + C C Sbjct: 319 PETMNNPLSHYW----ISSSHNTYLTGDQFSSESSLEAYARCLRMGC 361
>NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (hN2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 27.7 bits (60), Expect = 7.8 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = -2 Query: 193 CVCV-------CDRELCRCVNN*GNKGACTTGLIGMRKLSSAGYRSMHRRVQK 56 C+C C ++ C++N G CT GL G + L AG+ ++ V K Sbjct: 706 CICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDK 758
>NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (Motch B) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2470 Score = 27.7 bits (60), Expect = 7.8 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = -2 Query: 193 CVCV-------CDRELCRCVNN*GNKGACTTGLIGMRKLSSAGYRSMHRRVQK 56 C+C C ++ C++N G CT GL G + L AG+ ++ V K Sbjct: 704 CICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDK 756 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,245,541 Number of Sequences: 219361 Number of extensions: 780073 Number of successful extensions: 2015 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2013 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)