| Clone Name | rbastl45a12 |
|---|---|
| Clone Library Name | barley_pub |
>LAMB1_CHICK (Q01635) Laminin beta-1 chain (Laminin beta-1-1 chain) (Fragment)| Length = 303 Score = 31.6 bits (70), Expect = 0.53 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Frame = -1 Query: 99 NPSGLMCPVNL*----LPWRANEGNNNNPAGHCSCRG 1 N GL C L LPWR EG N+N C+C G Sbjct: 235 NTKGLNCEQCLDFYHDLPWRPAEGRNSNACKKCNCNG 271
>LAMB1_MOUSE (P02469) Laminin beta-1 chain precursor (Laminin B1 chain)| Length = 1786 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = -1 Query: 99 NPSGLMCPVNL*----LPWRANEGNNNNPAGHCSC 7 N GL C + + LPWR EG N+N C+C Sbjct: 303 NTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNC 337
>LAMB1_HUMAN (P07942) Laminin beta-1 chain precursor (Laminin B1 chain)| Length = 1786 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = -1 Query: 99 NPSGLMCPVNL*----LPWRANEGNNNNPAGHCSC 7 N GL C + + LPWR EG N+N C+C Sbjct: 303 NTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNC 337
>SPL16_ARATH (Q700C2) Squamosa promoter-binding-like protein 16 (SPL1-related| protein 3) Length = 988 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 191 SRQLQLTTPQKHSLPFITTSSRLYSTPHSNP 283 S QL ++P++ S P + +S++ YS+ SNP Sbjct: 351 SLQLFTSSPEEESRPKVASSTKYYSSASSNP 381
>GLB1_PHESE (P11740) Extracellular globin 1 (Globin I) (Erythrocruorin)| Length = 141 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +2 Query: 41 PSFALHGNHRFTGHINPLGLQIESDRFTAGLKHLRNDNT 157 P F HG G + +G+ E D FT L HL+ +T Sbjct: 57 PEFQAHGIRVLAGLDSVIGVLDEDDTFTVQLAHLKAQHT 95
>CDC14_CAEEL (P81299) Probable tyrosine-protein phosphatase cdc-14 (EC 3.1.3.48)| (Cell division cycle-related protein 14) Length = 1063 Score = 28.1 bits (61), Expect = 5.8 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 182 LNRSRQLQLTTPQKHSLPFITTSSRLYSTPHSN 280 LNR+R+ + TP K+ T+S +L +TP+ N Sbjct: 490 LNRNREPIIVTPSKNGTSSGTSSRQLKTTPNGN 522
>SCNA_DROME (P35500) Sodium channel protein para (Protein paralytic)| Length = 2131 Score = 27.7 bits (60), Expect = 7.6 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = -1 Query: 258 KRLDVVIKGKLCFCGVVSCSCLLRFKTTQWNSFYVLSLRRCFKPAVNLSLSIC 100 K L+V++KG FC V C C + K +W S V F P V L +++C Sbjct: 783 KALEVILKGIDVFC-VWDC-CWVWLKFQEWVSLIV------FDPFVELFITLC 827
>CHL1_ARATH (Q05085) Nitrate/chlorate transporter| Length = 590 Score = 27.3 bits (59), Expect = 10.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 188 GLRPPSGIPSMYCHCEDVSSLQ 123 GLRPP P+ HCE S +Q Sbjct: 124 GLRPPRCNPTTSSHCEQASGIQ 145
>PIGE_DROME (Q24118) Protein pigeon (Protein linotte)| Length = 915 Score = 27.3 bits (59), Expect = 10.0 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 6/45 (13%) Frame = +2 Query: 32 LLLPSFALHGNHR------FTGHINPLGLQIESDRFTAGLKHLRN 148 LL P+FALHG H F H+ +GLQ E + H R+ Sbjct: 351 LLRPTFALHGQHHLLVSSAFFVHLLDVGLQHEPNCHIVCAAHNRS 395
>SPL14_ARATH (Q8RY95) Squamosa promoter-binding-like protein 14 (SPL1-related| protein 2) Length = 1035 Score = 27.3 bits (59), Expect = 10.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 191 SRQLQLTTPQKHSLPFITTSSRLYSTPHSNP 283 S QL ++P+ S P + +S + YS+ SNP Sbjct: 389 SLQLFTSSPEDESRPTVASSRKYYSSASSNP 419
>DAMX_SERMA (P45459) Protein damX (Fragment)| Length = 214 Score = 27.3 bits (59), Expect = 10.0 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 191 SRQLQLTTPQKHSLPFITTSSRLYSTPHSNP 283 +R +Q T PQ+H P T +++ +T H +P Sbjct: 69 TRPVQGTAPQQHKTPAKTAAAKPTATQHKSP 99 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,166,693 Number of Sequences: 219361 Number of extensions: 842039 Number of successful extensions: 1817 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1817 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)