Clone Name | rbastl45a11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LAMB2_HUMAN (P55268) Laminin beta-2 chain precursor (S-laminin) ... | 28 | 5.9 | 2 | Y4650_STRCO (P41108) Putative lipoprotein SCO4650 precursor | 28 | 5.9 | 3 | YNV5_CAEEL (P34568) Hypothetical protein T16H12.5 | 28 | 7.8 |
---|
>LAMB2_HUMAN (P55268) Laminin beta-2 chain precursor (S-laminin) (Laminin B1s| chain) Length = 1798 Score = 28.1 bits (61), Expect = 5.9 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +1 Query: 127 CPAQLVNWWVGSGMQDFSSHGAGRARSPVCYGVQRPCHGRAG 252 C N G G Q + H + RAR P C CH RAG Sbjct: 1079 CAPNFWNLTSGHGCQPCACHPS-RARGPTCNEFTGQCHCRAG 1119
>Y4650_STRCO (P41108) Putative lipoprotein SCO4650 precursor| Length = 285 Score = 28.1 bits (61), Expect = 5.9 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +2 Query: 158 GAACRISHLMVQVALAPRCVTVCRGPVMGEPAGRS 262 G R + + V V+ A CVT C GP + AG S Sbjct: 3 GTTARRTVVSVAVSAALACVTACTGPGGSDDAGHS 37
>YNV5_CAEEL (P34568) Hypothetical protein T16H12.5| Length = 451 Score = 27.7 bits (60), Expect = 7.8 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +1 Query: 136 QLVNWWVGSGMQDFSSHGAGRARSPVCYGVQRPCHGRAGGPFP*SASPWEPLI 294 +LV+ VG G + S G+G + HGR+ P P SAS +PL+ Sbjct: 39 RLVSMEVGMGNDEVVSSGSGNS-----------AHGRSISPSPSSASHGDPLL 80 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,058,353 Number of Sequences: 219361 Number of extensions: 999033 Number of successful extensions: 2300 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2300 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)